UniProt ID | DMA1_SCHPO | |
---|---|---|
UniProt AC | Q10322 | |
Protein Name | Probable E3 ubiquitin-protein ligase dma1 | |
Gene Name | dma1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 267 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body . Localizes also at the division site in mitosis. | |
Protein Description | Probable E3 ubiquitin-protein ligase which is a component of the spindle assembly checkpoint, required to prevent septum formation and premature exit from mitosis if spindle function is compromised. Inhibits the septation initiation netwok (SIN) during spindle checkpoint activation. The effect appears to be mediated through preventing the SIN activator, plo1 kinase, from localizing to the SPB.. | |
Protein Sequence | MTKSVEGYLKEQELAAETDSEKDDDKISIRLTNFVGPNAHSFSFDPLVRYWNRKQNNLPIYIGRYTERYNGGDVSAIVFRSKVVSRRHAQIFYENNTWYIQDMGSSSGTFLNHVRLSPPSKTSKPYPISNNDILQLGADYRGGHEVNYRCVRARVELNNSWKIKLSPYNLNEFKRMQELVLCGSSESGPPECCICLMPVLPCQALFVAPCSHSYHYKCIRPTLNESHPYFSCFICRKYHDLEAPVEEGDESLNDLLRNATVKDDASE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTKSVEGYL ------CCCCCHHHH | 31.84 | 29996109 | |
4 | Phosphorylation | ----MTKSVEGYLKE ----CCCCCHHHHHH | 19.08 | 21712547 | |
18 | Phosphorylation | EQELAAETDSEKDDD HHHHHHCCCCCCCCC | 39.85 | 27738172 | |
251 | Phosphorylation | PVEEGDESLNDLLRN CHHCCCCCHHHHHHH | 36.89 | 21712547 | |
260 | Phosphorylation | NDLLRNATVKDDASE HHHHHHCCCCCCCCC | 31.47 | 21712547 | |
266 | Phosphorylation | ATVKDDASE------ CCCCCCCCC------ | 51.32 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DMA1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DMA1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DMA1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...