UniProt ID | MOB1_SCHPO | |
---|---|---|
UniProt AC | O94360 | |
Protein Name | Maintenance of ploidy protein mob1 | |
Gene Name | mob1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 210 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body . Spindle pole body throughout mitosis, relocates to the medial ring during interphase. | |
Protein Description | Has a role in promoting the onset of septum formation during the latter stages of mitosis.. | |
Protein Sequence | MFGFSNKTAKTFRVRKTEAGTKHYQLRQYAEATLGSGSLMEAVKLPKGEDLNEWIAMNTMDFYTQINMLYGTITEFCTAASCPQMNAGPSYEYYWQDDKIYTKPTRMSAPDYINNLLDWTQEKLDDKKLFPTEIGVEFPKNFRKVIQQIFRRLFRIYAHIYCSHFHVMVAMELESYLNTSFKHFVFFCREFGLMDNKEYAPMQDLVDSMV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MOB1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOB1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOB1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOB1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SCW1_SCHPO | scw1 | genetic | 12796296 | |
SCW1_SCHPO | scw1 | genetic | 12242222 | |
PP2B_SCHPO | ppb1 | genetic | 12354095 | |
ACE2_SCHPO | ace2 | genetic | 16415366 | |
SID2_SCHPO | sid2 | physical | 15060149 | |
CDC11_SCHPO | cdc11 | physical | 11676915 | |
SID2_SCHPO | sid2 | physical | 10769201 | |
SID2_SCHPO | sid2 | physical | 10837231 | |
CALM_SCHPO | cam1 | physical | 15004232 | |
ORB6_SCHPO | orb6 | genetic | 20805322 | |
2ABA_SCHPO | pab1 | genetic | 20876564 | |
2ABA_SCHPO | pab1 | physical | 20876564 | |
PTPA2_SCHPO | ypa2 | genetic | 22267499 | |
PP2A2_SCHPO | ppa2 | genetic | 22267499 | |
SID2_SCHPO | sid2 | genetic | 10769201 | |
SID4_SCHPO | sid4 | genetic | 10769201 | |
CDC11_SCHPO | cdc11 | genetic | 10769201 | |
CDC14_SCHPO | cdc14 | genetic | 10769201 | |
DMA1_SCHPO | dma1 | genetic | 10769201 | |
ZFS1_SCHPO | zfs1 | genetic | 10769201 | |
CDC7_SCHPO | cdc7 | genetic | 10769201 | |
SPG1_SCHPO | spg1 | genetic | 10769201 | |
CDC16_SCHPO | cdc16 | genetic | 10769201 | |
MLR4_SCHPO | cdc4 | genetic | 10769201 | |
AROG_SCHPO | SPAP8A3.07c | genetic | 22681890 | |
PDE1_SCHPO | cgs2 | genetic | 22681890 | |
YQK8_SCHPO | SPCC1494.08c | genetic | 22681890 | |
CDC11_SCHPO | cdc11 | physical | 24047983 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...