UniProt ID | CDC14_SCHPO | |
---|---|---|
UniProt AC | P36589 | |
Protein Name | Cell division control protein 14 | |
Gene Name | cdc14 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 240 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body . Localizes to the SPB prior to cytokinesis and leaves once septation is complete. | |
Protein Description | Has a role in the septation initiation network (SIN) required for cytokinesis.. | |
Protein Sequence | MEDLLNNAKQHLCMRNPKLIRIGLRQVESIVYHVAKPSHDDKIPREIFLKLQDSPLYNSTTPCIYALDSLLEYQQNEEAYEKNFQFIQKLIDDLLHVIEGLVLIHPKSQTLFEDKATLRLFIHLLQPSQPSMLQVAAMKTLVCIMADRPLAIRLFEQINGLQQICVVFKHKQTSQDTRFQILEFFYFYLSPEPYSIDVIAYRKTRTEKQAYLSKYLSNVQGLRDDLDKFQPFGKLDETFD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of CDC14_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDC14_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDC14_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDC14_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SID2_SCHPO | sid2 | genetic | 9649519 | |
SPG1_SCHPO | spg1 | genetic | 9649519 | |
SCW1_SCHPO | scw1 | genetic | 12796296 | |
HSP90_SCHPO | hsp90 | genetic | 11791728 | |
ZFS1_SCHPO | zfs1 | genetic | 10462526 | |
SCW1_SCHPO | scw1 | genetic | 12242222 | |
PP2B_SCHPO | ppb1 | genetic | 12354095 | |
GSK3_SCHPO | gsk3 | genetic | 8524294 | |
SCE3_SCHPO | sce3 | genetic | 9254700 | |
CTK1_SCHPO | lsk1 | genetic | 15537703 | |
ACE2_SCHPO | ace2 | genetic | 16415366 | |
SID1_SCHPO | sid1 | physical | 10775265 | |
SID1_SCHPO | sid1 | physical | 11384993 | |
CDC16_SCHPO | cdc16 | genetic | 1527180 | |
CDC15_SCHPO | cdc15 | genetic | 1527180 | |
ORB6_SCHPO | orb6 | genetic | 20805322 | |
PTPA2_SCHPO | ypa2 | genetic | 22267499 | |
DNT1_SCHPO | dnt1 | genetic | 17538026 | |
RRN5_SCHPO | rrn5 | genetic | 17538026 | |
RPA1_SCHPO | nuc1 | genetic | 17538026 | |
MYO2_SCHPO | myo2 | genetic | 17538026 | |
DNT1_SCHPO | dnt1 | genetic | 24006256 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...