dbPTM

CALM_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CALM_SCHPO
UniProt AC	P05933
Protein Name	Calmodulin
Gene Name	cam1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	150
Subcellular Localization	Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body . In the growing tips and spindle pole body during interphase and in the septum during septation. Component of a ring structure that forms prior to septation.
Protein Description	Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases..
Protein Sequence	MTTRNLTDEQIAEFREAFSLFDRDQDGNITSNELGVVMRSLGQSPTAAELQDMINEVDADGNGTIDFTEFLTMMARKMKDTDNEEEVREAFKVFDKDGNGYITVEELTHVLTSLGERLSQEEVADMIREADTDGDGVINYEEFSRVISSK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
7	Phosphorylation	-MTTRNLTDEQIAEF -CCCCCCCHHHHHHH	40.83	25720772
132	Phosphorylation	DMIREADTDGDGVIN HHHHHCCCCCCCCCC	49.26	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CALM_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CALM_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CALM_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PCP1_SCHPO	pcp1	physical	11864908
RNG2_SCHPO	rng2	physical	9635188
SPO15_SCHPO	spo15	physical	20833892
SPO2_SCHPO	spo2	physical	20833892
SPO13_SCHPO	spo13	physical	20833892
SPO15_SCHPO	spo15	genetic	20833892

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CALM_SCHPO

Related Literatures of Post-Translational Modification