SPO2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPO2_SCHPO
• UniProt AC: C6Y4C2
• Protein Name: Sporulation-specific protein 2
• Gene Name: spo2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 133
• Subcellular Localization: Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body .
• Protein Description: Involved in sporulation. Plays a significant role in modification of the spindle pole body prior to spore formation and is required for initiating forespore membrane formation. Assists in the localization of spo13 to the outer surface of the SPB..
• Protein Sequence: MSITMSDSSAYGEELMRERFEHLLKAYEKMALMVAEQEEFNAKIEDMALKLLSEKYDNEAYQAELFYRLSNCVEKVLHNKISITDLKTEYEEILEQTLKKECKAYERSCIENVKLKKRTEQATAYYASSSSEP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SPO2_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPO2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPO2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPO2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YH7G_SCHPO	SPBC16G5.16	physical	26771498
ATF21_SCHPO	atf21	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.