UniProt ID | 2ABA_SCHPO | |
---|---|---|
UniProt AC | Q12702 | |
Protein Name | Protein phosphatase PP2A regulatory subunit B | |
Gene Name | pab1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 463 | |
Subcellular Localization | ||
Protein Description | Phosphatase 2A affects a variety of biological processes in the cell such as transcription, cell cycle progression and cellular morphogenesis, and provides an initial identification of critical substrates for this phosphatase. The regulatory subunit may direct the catalytic subunit to distinct, albeit overlapping, subsets of substrates.. | |
Protein Sequence | MDDIEDSLDQWKFAQCFGDKGDVEDITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKFFTEFQSHEPEFDYLKSLEIEEKINKIRWCKRTNRAHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMIIAAYPRRVYANAHAYHINSISVNSDAETYISADDLRINLWNLSISDHSFNIVDIKPENMEELTEVITSAEFHPINCNHLMYSSSKGNIKLLDLRQSALCDNPCKLFEDQEDQDSKSFFSEIISSISDVKFSQNGRYILSRDYLTLKIWDVNMEKAPVKTIPLHDVLRSKLCDLYENDCIFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAFRARKSAANNVPKLNAVKNNDWRSQPQAAMGSASVGLDPDNLDYNKKILHASWHPFEDSVAIAATNNLFVFSKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
134 | Phosphorylation | VVAENNLSDSFHSPM EEEECCCCCCCCCCC | 33.07 | 28889911 | |
136 | Phosphorylation | AENNLSDSFHSPMQG EECCCCCCCCCCCCC | 22.83 | 25720772 | |
139 | Phosphorylation | NLSDSFHSPMQGPLT CCCCCCCCCCCCCCC | 21.76 | 25720772 | |
146 | Phosphorylation | SPMQGPLTTPSQLRL CCCCCCCCCHHHCCC | 39.53 | 29996109 | |
147 | Phosphorylation | PMQGPLTTPSQLRLP CCCCCCCCHHHCCCC | 28.73 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 2ABA_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 2ABA_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 2ABA_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MOB1_SCHPO | mob1 | physical | 20876564 | |
WEE1_SCHPO | wee1 | genetic | 20876564 | |
CDK1_SCHPO | cdc2 | genetic | 20876564 | |
PP11_SCHPO | dis2 | physical | 25487150 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...