2ABA_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: 2ABA_SCHPO
• UniProt AC: Q12702
• Protein Name: Protein phosphatase PP2A regulatory subunit B
• Gene Name: pab1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 463
• Protein Description: Phosphatase 2A affects a variety of biological processes in the cell such as transcription, cell cycle progression and cellular morphogenesis, and provides an initial identification of critical substrates for this phosphatase. The regulatory subunit may direct the catalytic subunit to distinct, albeit overlapping, subsets of substrates..
• Protein Sequence: MDDIEDSLDQWKFAQCFGDKGDVEDITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKFFTEFQSHEPEFDYLKSLEIEEKINKIRWCKRTNRAHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMIIAAYPRRVYANAHAYHINSISVNSDAETYISADDLRINLWNLSISDHSFNIVDIKPENMEELTEVITSAEFHPINCNHLMYSSSKGNIKLLDLRQSALCDNPCKLFEDQEDQDSKSFFSEIISSISDVKFSQNGRYILSRDYLTLKIWDVNMEKAPVKTIPLHDVLRSKLCDLYENDCIFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAFRARKSAANNVPKLNAVKNNDWRSQPQAAMGSASVGLDPDNLDYNKKILHASWHPFEDSVAIAATNNLFVFSKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
134	Phosphorylation	VVAENNLSDSFHSPM EEEECCCCCCCCCCC	33.07	28889911
136	Phosphorylation	AENNLSDSFHSPMQG EECCCCCCCCCCCCC	22.83	25720772
139	Phosphorylation	NLSDSFHSPMQGPLT CCCCCCCCCCCCCCC	21.76	25720772
146	Phosphorylation	SPMQGPLTTPSQLRL CCCCCCCCCHHHCCC	39.53	29996109
147	Phosphorylation	PMQGPLTTPSQLRLP CCCCCCCCHHHCCCC	28.73	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of 2ABA_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of 2ABA_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of 2ABA_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MOB1_SCHPO	mob1	physical	20876564
WEE1_SCHPO	wee1	genetic	20876564
CDK1_SCHPO	cdc2	genetic	20876564
PP11_SCHPO	dis2	physical	25487150

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of fission yeast.";
Wilson-Grady J.T., Villen J., Gygi S.P.;
J. Proteome Res. 7:1088-1097(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-134, AND MASSSPECTROMETRY.
PubMed: 18257517