UniProt ID | PP11_SCHPO | |
---|---|---|
UniProt AC | P13681 | |
Protein Name | Serine/threonine-protein phosphatase PP1-1 | |
Gene Name | dis2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 327 | |
Subcellular Localization | Nucleus. | |
Protein Description | Essential role in cell cycle control. PP1 is perhaps required for exit from mitosis.. | |
Protein Sequence | MSNPDVDLDSIIDRLLEVRGSRPGRQVQLSEDEIRFLCNKAREIFISQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLEVICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLNSMDQIQRIMRPTDVPDTGLLCDLLWSDPDKDLTGWGDNDRGVSFTFGPDVVSRFLHKHDMDLVCRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEKKQRYGYQGSSQNWHMTPPRKNKTGNSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSNPDVDLD ------CCCCCCCHH | 58.00 | 29996109 | |
309 | Phosphorylation | QRYGYQGSSQNWHMT HHHCCCCCCCCCCCC | 17.15 | 29996109 | |
310 | Phosphorylation | RYGYQGSSQNWHMTP HHCCCCCCCCCCCCC | 34.06 | 29996109 | |
316 | Phosphorylation | SSQNWHMTPPRKNKT CCCCCCCCCCCCCCC | 19.77 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
316 | T | Phosphorylation | Kinase | CDK1 | P04551 | GPS |
316 | T | Phosphorylation | Kinase | CDK-FAMILY | - | GPS |
316 | T | Phosphorylation | Kinase | CDK_GROUP | - | PhosphoELM |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP11_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP11_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...