| UniProt ID | YTH1_SCHPO | |
|---|---|---|
| UniProt AC | Q9UTD1 | |
| Protein Name | mRNA 3'-end-processing protein yth1 | |
| Gene Name | yth1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 170 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Component of the cleavage factor I (CF I) involved in pre-mRNA 3'-end processing.. | |
| Protein Sequence | MTDYIKDKAIAADFSSVQFRFDNYLKQNFNFGRSALLNSGNGRDSGSKMGSVVCKHWLRGLCKKGEQCDFLHEYNLKKMPPCHFYAERGWCSNGEECLYLHLDPSKQVGVCAWYNMGFCPLGPICRGKHVRKPRPCPKYLAGFCPLGPNCPDAHPKHSEPPHPPQKRKDW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YTH1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YTH1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YTH1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YTH1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PFS2_SCHPO | pfs2 | physical | 24945319 | |
| CFT1_SCHPO | cft1 | physical | 24945319 | |
| CFT2_SCHPO | cft2 | physical | 24945319 | |
| PAP_SCHPO | pla1 | physical | 24945319 | |
| PTA1_SCHPO | pta1 | physical | 24945319 | |
| YSH1_SCHPO | ysh1 | physical | 24945319 | |
| CPSFX_SCHPO | ppn1 | physical | 24945319 | |
| PP11_SCHPO | dis2 | physical | 24945319 | |
| SSU72_SCHPO | ssu72 | physical | 24945319 | |
| YIQ4_SCHPO | SPAC824.04 | physical | 24945319 | |
| SRP2_SCHPO | srp2 | physical | 24945319 | |
| FIP1X_SCHPO | iss1 | physical | 24945319 | |
| CTF1_SCHPO | ctf1 | physical | 24945319 | |
| SRP1_SCHPO | srp1 | physical | 24945319 | |
| YHKF_SCHPO | SPBC660.15 | physical | 24945319 | |
| FIP1X_SCHPO | iss1 | physical | 26771498 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
