UniProt ID | DAM1_SCHPO | |
---|---|---|
UniProt AC | Q9HDZ6 | |
Protein Name | DASH complex subunit dam1 | |
Gene Name | dam1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 155 | |
Subcellular Localization | Nucleus . Cytoplasm, cytoskeleton, spindle . Chromosome, centromere, kinetochore . Associates with the mitotic spindle and the kinetochore. Kinetochore association occurs only during mitosis. | |
Protein Description | Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore.. | |
Protein Sequence | MEKYQKATQNPLENVDNVKIESENAIPSNLQAFTKSLAVLDDNVSEFRKRMNHLSATKQILDNFNESFSSFLYGLQINAFCVDYENAPLSESFLLQAKKDQFKATLMTRTGHSISDPPYDGGVISHDPNFATADETFATNDTSFIERPETYSASR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of DAM1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DAM1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DAM1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DAM1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...