dbPTM

RT109_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RT109_SCHPO
UniProt AC	Q9Y7Y5
Protein Name	Histone acetyltransferase rtt109
Gene Name	rtt109
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	369
Subcellular Localization	Nucleus .
Protein Description	Required for acetylation of 'Lys-56' of histone H3 (H3K56ac), which occurs predominantly in newly synthesized H3 molecule during G1, S-phase and G2/M of cell cycle. Histone H3 'Lys-56' acetylation is required for S-phase-linked DNA damage tolerance and proper silencing in pericentromeric heterochromatin..
Protein Sequence	MPDLWSESILEGRKLSIYHLKSTLEKCPFLFGQSKKSKDFQFGSHLFLVEEQNVFIFGMECIVYEKNKEFIVFVSKADSTGFGSKGVSCNSLAFCCLVTLIDGLRKQGAENVTLTLFAIAQGQYLFPESVDNGQKHVLNDSGLLRWWVNCLEKLRKYYTDSEAPNDSEKQKNSTLLPKAYLFVPGLENIRSYLPNRHWIESNAITTGKAVEELPRFPDDPKCRYLCELQDEKSDMSVEEFWDTLTYRQECSSGKLVGFFTLQLQFYQTREFIAKDNFGDSGVMIPAKLYRVTYDTLLKHPFGSLSDAQSSTEKFLSNTLSAVQNLKDFHYKRYKLDICGLAKRDDRKNHNHSKPATQANILQPRKKVKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RT109_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RT109_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RT109_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RT109_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CLR4_SCHPO	clr4	genetic	18818364
TAS3_SCHPO	tas3	genetic	18818364
DCN1_SCHPO	SPBC839.03c	genetic	18818364
HRR1_SCHPO	hrr1	genetic	18818364
CAF1_SCHPO	caf1	genetic	18818364
CCR4_SCHPO	ccr4	genetic	18818364
RAF1_SCHPO	raf1	genetic	18818364
CID12_SCHPO	cid12	genetic	18818364
AGO1_SCHPO	ago1	genetic	18818364
RAF2_SCHPO	raf2	genetic	18818364
DDB1_SCHPO	ddb1	genetic	22681890
RIK1_SCHPO	rik1	genetic	22681890
NSE6_SCHPO	nse6	genetic	22681890
DCN1_SCHPO	SPBC839.03c	genetic	22681890
YCX5_SCHPO	dbl1	genetic	22681890
RAF2_SCHPO	raf2	genetic	22681890
RFA3_SCHPO	ssb3	genetic	22681890
CTBL1_SCHPO	SPAC1952.06c	genetic	22681890
YAC5_SCHPO	cph1	genetic	22681890
DEP1_SCHPO	dep1	genetic	22681890
RAD17_SCHPO	rad17	genetic	22681890
BST1_SCHPO	bst1	genetic	22681890
CLR4_SCHPO	clr4	genetic	22681890
RAD1_SCHPO	rad1	genetic	22681890
HRQ1_SCHPO	hrq1	genetic	22681890
SNF5_SCHPO	snf5	genetic	22681890
MUG80_SCHPO	mug80	genetic	22681890
THI5_SCHPO	thi5	genetic	22681890
RAD57_SCHPO	rad57	genetic	22681890
SSN3_SCHPO	srb10	genetic	22681890
HUS1_SCHPO	hus1	genetic	22681890
POF3_SCHPO	pof3	genetic	22681890
RAF1_SCHPO	raf1	genetic	22681890
CLR3_SCHPO	clr3	genetic	22681890
FFT3_SCHPO	fft3	genetic	22681890
CGM2_SCHPO	mcs2	genetic	22681890
PRZ1_SCHPO	prz1	genetic	22681890
YI43_SCHPO	SPBC1348.03	genetic	22681890
H2AZ_SCHPO	pht1	genetic	24687850

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RT109_SCHPO

Related Literatures of Post-Translational Modification