| UniProt ID | NACA_SCHPO | |
|---|---|---|
| UniProt AC | P87147 | |
| Protein Name | Nascent polypeptide-associated complex subunit alpha | |
| Gene Name | egd2 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 173 | |
| Subcellular Localization | Cytoplasm. Nucleus. Predominantly cytoplasmic, may also transiently localize to the nucleus.. | |
| Protein Description | Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. Ucp15 may also be involved in transcription regulation (By similarity).. | |
| Protein Sequence | MSVESQPVEKISELPAGSTTVVHAEKAQKLIQKLGLKRVEGITRVAMRRPKNILLIINEPIVYKSSNNAYIVLGKVTVEDMAAQARAFNESQKQATETKEEAAITEESGDAQPADTAKIEESFEQEKAVDETGVDAKDIELVMAQANVSRAKAVTALKENNSDVVNAIMSLTM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSVESQPVE ------CCCCCCCCC | 34.29 | 24763107 | |
| 5 | Phosphorylation | ---MSVESQPVEKIS ---CCCCCCCCCHHH | 37.31 | 24763107 | |
| 18 | Phosphorylation | ISELPAGSTTVVHAE HHCCCCCCEEEEEHH | 24.02 | 25720772 | |
| 19 | Phosphorylation | SELPAGSTTVVHAEK HCCCCCCEEEEEHHH | 23.77 | 24763107 | |
| 20 | Phosphorylation | ELPAGSTTVVHAEKA CCCCCCEEEEEHHHH | 23.41 | 29996109 | |
| 66 | Phosphorylation | EPIVYKSSNNAYIVL CCEEEECCCCEEEEE | 29.92 | 25720772 | |
| 91 | Phosphorylation | QARAFNESQKQATET HHHHHCHHHHHHHHC | 43.72 | 27738172 | |
| 105 | Phosphorylation | TKEEAAITEESGDAQ CHHHHHHCCCCCCCC | 29.04 | 25720772 | |
| 108 | Phosphorylation | EAAITEESGDAQPAD HHHHCCCCCCCCCCC | 35.42 | 25720772 | |
| 116 | Phosphorylation | GDAQPADTAKIEESF CCCCCCCCHHHHHHH | 31.77 | 21712547 | |
| 122 | Phosphorylation | DTAKIEESFEQEKAV CCHHHHHHHHHHHCC | 22.69 | 28889911 | |
| 149 | Phosphorylation | VMAQANVSRAKAVTA HHHHCCCCHHHHHHH | 26.74 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NACA_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NACA_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NACA_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NACA_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...