YNH1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YNH1_SCHPO
• UniProt AC: Q9C0V9
• Protein Name: UPF0589 protein C32H8.01c
• Gene Name: SPBC32H8.01c, SPBP22H7.10c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 187
• Protein Sequence: MLKKMPMSNKFENFYTLRQVSEVDKKPCFICYKPTKWVLITKTKLDFFYVCYNHLQDRGFATPISVIKSVTNKIDTNKLEAKDESKNVEKDATGNPQESKQEPNLEVQQTEKEKDVDSASAENESINSSSSSSKECSTQTQSKHYNLHRDIFQMRIRYHANRAAAEKTARLLQSGQGLPSPPSKPLP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
120	Phosphorylation	EKDVDSASAENESIN HHCCCHHHHHCCCCC	39.81	25720772
180	Phosphorylation	QSGQGLPSPPSKPLP HCCCCCCCCCCCCCC	55.26	28889911
183	Phosphorylation	QGLPSPPSKPLP--- CCCCCCCCCCCC---	50.73	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YNH1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YNH1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YNH1_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YNH1_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.