SNF7_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SNF7_SCHPO
• UniProt AC: Q9P7F7
• Protein Name: Vacuolar-sorting protein snf7
• Gene Name: snf7
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 222
• Subcellular Localization: Cytoplasm. Endosome membrane; Peripheral membrane protein.
• Protein Description: Required for the sorting and concentration of proteins resulting in the entry of these proteins into the invaginating vesicles of the multivesicular body (MVB)..
• Protein Sequence: MSGFLRWFGGNRSKDTTKDTIVRFQEMLALYDKKEEVLERQIAEQTEIARKNATTNKRLALTALKRKKMHENELVKIEGSRNNIEQQLFSIQNANLNFETLQAMRQGAEAMKSIQRGMDADKVDQIMDKIRDQQTISEEISTMISTPVGLNAEIDEDELANELDELQQMELDSKMLGAEKPPVHTPAVPAVPSQVKDLPSISKPQELDEEEELRKLQAEFSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
193	Phosphorylation	PAVPAVPSQVKDLPS CCCCCCCCCCCCCCC	40.79	24763107
200	Phosphorylation	SQVKDLPSISKPQEL CCCCCCCCCCCCCCC	46.95	21712547
221	Phosphorylation	RKLQAEFSL------ HHHHHHHCC------	25.36	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SNF7_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SNF7_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SNF7_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VPS20_SCHPO	vps20	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.