UniProt ID | SNF7_SCHPO | |
---|---|---|
UniProt AC | Q9P7F7 | |
Protein Name | Vacuolar-sorting protein snf7 | |
Gene Name | snf7 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 222 | |
Subcellular Localization |
Cytoplasm. Endosome membrane Peripheral membrane protein. |
|
Protein Description | Required for the sorting and concentration of proteins resulting in the entry of these proteins into the invaginating vesicles of the multivesicular body (MVB).. | |
Protein Sequence | MSGFLRWFGGNRSKDTTKDTIVRFQEMLALYDKKEEVLERQIAEQTEIARKNATTNKRLALTALKRKKMHENELVKIEGSRNNIEQQLFSIQNANLNFETLQAMRQGAEAMKSIQRGMDADKVDQIMDKIRDQQTISEEISTMISTPVGLNAEIDEDELANELDELQQMELDSKMLGAEKPPVHTPAVPAVPSQVKDLPSISKPQELDEEEELRKLQAEFSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
193 | Phosphorylation | PAVPAVPSQVKDLPS CCCCCCCCCCCCCCC | 40.79 | 24763107 | |
200 | Phosphorylation | SQVKDLPSISKPQEL CCCCCCCCCCCCCCC | 46.95 | 21712547 | |
221 | Phosphorylation | RKLQAEFSL------ HHHHHHHCC------ | 25.36 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNF7_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNF7_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNF7_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VPS20_SCHPO | vps20 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...