dbPTM

VPS20_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VPS20_SCHPO
UniProt AC	O94318
Protein Name	Vacuolar protein sorting-associated protein 20
Gene Name	vps20
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	226
Subcellular Localization	Endosome membrane Peripheral membrane protein. Vacuole membrane Peripheral membrane protein. Cytoplasm, cell cortex .
Protein Description	Class E VPS protein implicated in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles. The lumenal sequestrated membrane proteins will be targeted into the vacuole after fusion of the endosome with the vacuole..
Protein Sequence	MGVNSSKINDKDRSILSIKEQRDKLLRYSKRLEKIEQLEIDIARKCLRDSDKRGALRALKAKKLYSGLITQTYGQLGNIEQLLSTIEFTLIQKDVMFGLQEGTNLIRQLQADMPLERVGRICNDRDEAMSYVDEVNDMLQGRMSRDQEDEIQEELDSLIREQEDEKVKDLEKPGFTPSTGVDVLPSVPLKNAIPSLDESFPKAASVSNTSSAVVIDEELRKDPVLG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGVNSSKIN ------CCCCHHHCC	27.58	-
195	Phosphorylation	PLKNAIPSLDESFPK CCCCCCCCCCCCCCC	42.19	25720772
205	Phosphorylation	ESFPKAASVSNTSSA CCCCCCCCCCCCCCE	30.82	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VPS20_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VPS20_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VPS20_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CLR3_SCHPO	clr3	genetic	19547744
SNF8_SCHPO	dot2	physical	23695164
VPS20_SCHPO	vps20	physical	26771498
SNF8_SCHPO	dot2	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VPS20_SCHPO

Related Literatures of Post-Translational Modification