UniProt ID | VPS20_SCHPO | |
---|---|---|
UniProt AC | O94318 | |
Protein Name | Vacuolar protein sorting-associated protein 20 | |
Gene Name | vps20 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 226 | |
Subcellular Localization |
Endosome membrane Peripheral membrane protein. Vacuole membrane Peripheral membrane protein. Cytoplasm, cell cortex . |
|
Protein Description | Class E VPS protein implicated in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles. The lumenal sequestrated membrane proteins will be targeted into the vacuole after fusion of the endosome with the vacuole.. | |
Protein Sequence | MGVNSSKINDKDRSILSIKEQRDKLLRYSKRLEKIEQLEIDIARKCLRDSDKRGALRALKAKKLYSGLITQTYGQLGNIEQLLSTIEFTLIQKDVMFGLQEGTNLIRQLQADMPLERVGRICNDRDEAMSYVDEVNDMLQGRMSRDQEDEIQEELDSLIREQEDEKVKDLEKPGFTPSTGVDVLPSVPLKNAIPSLDESFPKAASVSNTSSAVVIDEELRKDPVLG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGVNSSKIN ------CCCCHHHCC | 27.58 | - | |
195 | Phosphorylation | PLKNAIPSLDESFPK CCCCCCCCCCCCCCC | 42.19 | 25720772 | |
205 | Phosphorylation | ESFPKAASVSNTSSA CCCCCCCCCCCCCCE | 30.82 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPS20_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPS20_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPS20_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CLR3_SCHPO | clr3 | genetic | 19547744 | |
SNF8_SCHPO | dot2 | physical | 23695164 | |
VPS20_SCHPO | vps20 | physical | 26771498 | |
SNF8_SCHPO | dot2 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...