UniProt ID | PP12_SCHPO | |
---|---|---|
UniProt AC | P23880 | |
Protein Name | Serine/threonine-protein phosphatase PP1-2 | |
Gene Name | sds21 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 322 | |
Subcellular Localization | ||
Protein Description | Essential role in cell cycle control. PP1 is perhaps required for exit from mitosis.. | |
Protein Sequence | MDYDIDAIIEKLVKARNGKPSKQVQLSDAEIRYLCTTSRSIFLSQPMLLELEAPLKICGDIHGQYSDLLRLFEYGGYPPDANYLFLGDYVDRGKQSLEVICLLFAYKIKYPENFFLLRGNHEFASINRIYGFYDECKRRYSIKLWKTFTDCFNCMPVAAVIDEKIFCMHGGLSPDLNSLDQIQRIIRPTDIPDTGLLCDLVWSDPEKDLTGWGENDRGVSYTFGADVVSRFLQKHDLDLICRAHQVVEDGYEFFGKRQLVTIFSAPNYCGEFDNVGAMMSVNEDLLCSFQILKPAEKRQRVSQSSIKESKSATNSLKKSKNN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
302 | Phosphorylation | AEKRQRVSQSSIKES HHHCHHCCHHHHHHH | 26.91 | 21712547 | |
304 | Phosphorylation | KRQRVSQSSIKESKS HCHHCCHHHHHHHHH | 26.90 | 21712547 | |
305 | Phosphorylation | RQRVSQSSIKESKSA CHHCCHHHHHHHHHH | 30.00 | 21712547 | |
313 | Phosphorylation | IKESKSATNSLKKSK HHHHHHHHHHHHHHC | 32.22 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP12_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP12_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP12_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RIF1_SCHPO | rif1 | physical | 24656819 | |
HSP60_SCHPO | mcp60 | physical | 24945319 | |
CMB1_SCHPO | cmb1 | physical | 24945319 | |
YE99_SCHPO | glc9 | physical | 24945319 | |
SDS22_SCHPO | sds22 | physical | 24945319 | |
UCP3_SCHPO | ucp3 | physical | 24945319 | |
RAD24_SCHPO | rad24 | physical | 24945319 | |
LYS9_SCHPO | SPBC3B8.03 | physical | 24945319 | |
TEA4_SCHPO | tea4 | physical | 24945319 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...