SDS22_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SDS22_SCHPO
• UniProt AC: P22194
• Protein Name: Protein phosphatase 1 regulatory subunit SDS22
• Gene Name: sds22
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 332
• Subcellular Localization: Nucleus.
• Protein Description: Essential for the mitotic metaphase/anaphase transition. Positively modulates protein phosphatase-1, possibly by forming a repeating helical rod that is capable of enhancing a PP1-dependent dephosphorylation activity..
• Protein Sequence: MSNVSSEDGIAPETQLIIDDPDVQQIDADEDLLDDVPDDVDCVELIQSRIQSMASLGLERFKNLQSLCLRQNQIKKIESVPETLTELDLYDNLIVRIENLDNVKNLTYLDLSFNNIKTIRNINHLKGLENLFFVQNRIRRIENLEGLDRLTNLELGGNKIRVIENLDTLVNLEKLWVGKNKITKFENFEKLQKLSLLSIQSNRITQFENLACLSHCLRELYVSHNGLTSFSGIEVLENLEILDVSNNMIKHLSYLAGLKNLVELWASNNELSSFQEIEDELSGLKKLETVYFEGNPLQKTNPAVYRNKVRLCLPQLRQIDATIIPKTSKQFP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SDS22_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SDS22_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SDS22_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SDS22_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PP12_SCHPO	sds21	genetic	1846086
SDS23_SCHPO	sds23	genetic	1846086
YHI5_SCHPO	abo2	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.