dbPTM

NSE5_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NSE5_SCHPO
UniProt AC	O94668
Protein Name	Non-structural maintenance of chromosome element 5
Gene Name	nse5
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	388
Subcellular Localization	Cytoplasm . Nucleus . Chromosome .
Protein Description	Acts in a DNA repair pathway for removal of UV-induced DNA damage that is distinct from classical nucleotide excision repair and in repair of ionizing radiation damage. Functions in homologous recombination repair of DNA double strand breaks and in recovery of stalled replication forks. May prevent formation of excessive Holliday junctions or assist in their resolution..
Protein Sequence	MNSALKAIIELCIEEDLLPKSLDVLEYLLSTTSIPIPACYIRMCITLLVHPEYPTSSNIQESCNWILQQVVENRSKINFDAWSFENDLSDNDMPKENYLKIFSNQCLFTQDVDYWDLIAYMSSRPPDLERWMSLMDIWLRILEIDAEENGSALMKKYMGEDLCELQDAIRICFSCFTLPQQTMESPFATSMSKAPAKTESRGSNSFEGTSRLANLGAKLLCLIWAMLPKGRFFVVHLTDAFHFLSKLDERFSKLNAKQQDLFFGNLGASNLRYCLSQYILMKGIGIGINIRHTRCEFTKQLTQLLPTSLPKNKIRQKLHLRAWVSFLGSALRESDRNFDKELFYTTLKQLYTMYQQTELVGIDRPMAILKDMLVLLDISKKLSLDKIV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
383	Phosphorylation	LDISKKLSLDKIV-- HHHHHHCCCCCCC--	43.32	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NSE5_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NSE5_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NSE5_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NSE1_SCHPO	nse1	physical	16478984
NSE6_SCHPO	nse6	physical	16478984
SMC5_SCHPO	smc5	physical	17005570
SMC6_SCHPO	smc6	physical	17005570
RSV2_SCHPO	rsv2	genetic	18931302
KLP6_SCHPO	klp6	genetic	18931302
RNH2B_SCHPO	SPBC1347.08c	genetic	18931302
PAN3_SCHPO	ppk26	genetic	18931302
FBH1_SCHPO	fbh1	genetic	18931302
YHHB_SCHPO	hmo1	genetic	18931302
CSN1_SCHPO	csn1	genetic	18931302
ATC1_SCHPO	pmr1	genetic	18931302
BQT4_SCHPO	bqt4	genetic	18931302
MSH2_SCHPO	msh2	genetic	18931302
RAD3_SCHPO	rad3	genetic	18931302
SWI10_SCHPO	swi10	genetic	18931302
ALG6_SCHPO	alg6	genetic	18931302
KU80_SCHPO	pku80	genetic	18931302
RAD13_SCHPO	rad13	genetic	18931302
RAD14_SCHPO	rhp14	genetic	18931302
CSN5_SCHPO	csn5	genetic	18931302
PLI1_SCHPO	pli1	genetic	18931302
PNK1_SCHPO	pnk1	genetic	18931302
CSN7_SCHPO	csn71	genetic	18931302
DDB1_SCHPO	ddb1	genetic	18931302
CUL3_SCHPO	cul3	genetic	18931302
DCC1_SCHPO	dcc1	genetic	18931302
FEN1_SCHPO	rad2	genetic	18931302
YDEF_SCHPO	SPAC12B10.15c	genetic	18931302
MRC1_SCHPO	mrc1	genetic	18931302
RAD26_SCHPO	rad26	genetic	18931302
ASE1_SCHPO	ase1	genetic	18931302
SRS2_SCHPO	srs2	genetic	18931302
SWI3_SCHPO	swi3	genetic	18931302
SWR1_SCHPO	swr1	genetic	18931302
BRL2_SCHPO	brl2	physical	17762865
NSE6_SCHPO	nse6	physical	17762865
SMC5_SCHPO	smc5	physical	16478984
SMC6_SCHPO	smc6	physical	16478984
NSE2_SCHPO	nse2	physical	16478984
NSE3_SCHPO	nse3	physical	16478984
YJNJ_SCHPO	nts1	genetic	25002536

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NSE5_SCHPO

Related Literatures of Post-Translational Modification