| UniProt ID | RAD14_SCHPO | |
|---|---|---|
| UniProt AC | O59753 | |
| Protein Name | DNA repair protein rad14 {ECO:0000305} | |
| Gene Name | rhp14 {ECO:0000303|PubMed:11408483} | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 289 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Involved in nucleotide excision repair (NER). Functional in repair of ultraviolet radiation induced damages and in mitotic mutation avoidance. Binds damaged DNA. Binds specifically to base-base mismatches or small insertion/deletion loops with unpaired nucleotides. Maintains GT repeat stability. Functions as a part of the short-patch excision repair system.. | |
| Protein Sequence | MENSSIVKSPNPTIEEQRNEIEKLKNLTGIEEVHVDGAKVNKRKRTFDEQSEITKDYIEYDFSKIEDTKGGYLLEEKKVEDLREKPAERELREQEERQKKLRLAPLNLDPETAPKCFECDSIELDTKYFDIFHCRVCHTCREKYPDKYSLLTKTECKLDYLLTEPELQDQELLPRLLKANPHQQGWSNMMLYLRYQVEEFAKKKWGSMEALDAEFERREVQKKEMKEKKFEKQLLELRKRTRTSNYSRMSIREKRKHVHSYDEEFEKPNEPGVIVQRCKCGLEIEQLEI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MENSSIVKSPN ----CCCCCCCCCCC | 14.24 | 29996109 | |
| 5 | Phosphorylation | ---MENSSIVKSPNP ---CCCCCCCCCCCC | 42.87 | 29996109 | |
| 9 | Phosphorylation | ENSSIVKSPNPTIEE CCCCCCCCCCCCHHH | 21.00 | 28889911 | |
| 13 | Phosphorylation | IVKSPNPTIEEQRNE CCCCCCCCHHHHHHH | 47.89 | 29996109 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAD14_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAD14_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAD14_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
