TLG2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TLG2_SCHPO
• UniProt AC: Q9P6P1
• Protein Name: t-SNARE affecting a late Golgi compartment protein 2
• Gene Name: tlg2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 301
• Subcellular Localization: Golgi apparatus, trans-Golgi network membrane; Single-pass type IV membrane protein. Endosome membrane; Single-pass type IV membrane protein.
• Protein Description: t-SNARE that functions in transport from the endosome to the late Golgi and on the endocytic pathway..
• Protein Sequence: MAYRDRTGLYITFRQSYSHHGQRLELSGWDPKEERQSLVHKDNKDNTVIEMDMLAPRWVTVEGEIDSLLLNTRRNINLLDKQYAKHVLPSFSDKTEQENEIQRLTIQITQDFQRCQKLLQVTKAQTNSATGSEALMAKNFLSNLASRIQTESAQFRKKQSTYLKKLRGLNANISPVESKLDETVSDVAISQSTIQQVALMEEQGEDEQAIRHERAVAKIAEGIIELAQMFQDLQVLVIEQGALVDRIDFNIEQTQVHAKSAEKELIKAESHQKNTGRLRFICFLILLIVALIVILAIKLLR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
174	Phosphorylation	RGLNANISPVESKLD HCCCCCCCCCHHHHC	23.77	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TLG2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TLG2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TLG2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAD17_SCHPO	rad17	genetic	18931302
HUS1_SCHPO	hus1	genetic	18931302
PYP1_SCHPO	pyp1	genetic	18931302
YFE6_SCHPO	gmh5	genetic	18931302

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.