UniProt ID | ATL1_SCHPO | |
---|---|---|
UniProt AC | Q9UTN9 | |
Protein Name | Alkyltransferase-like protein 1 {ECO:0000303|PubMed:16679453} | |
Gene Name | atl1 {ECO:0000303|PubMed:16679453} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 108 | |
Subcellular Localization | ||
Protein Description | Involved in DNA damage recognition. Binds DNA containing O(6)-methylguanine and larger O(6)-alkylguanine adducts. The DNA is bent, the damaged base is rotated out of the DNA duplex into a hydrophobic binding pocket (nucleotide flipping), with Arg-39 donating a hydrogen bond to the orphaned cytosine to stabilize the extrahelical DNA conformation. This structural change in DNA presents the lesion to the nucleotide excision repair (NER) pathway. [PubMed: 16679453] | |
Protein Sequence | MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ATL1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATL1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATL1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATL1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAD14_SCHPO | rhp14 | genetic | 19516334 | |
FEN1_SCHPO | rad2 | genetic | 19516334 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...