dbPTM

ATL1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ATL1_SCHPO
UniProt AC	Q9UTN9
Protein Name	Alkyltransferase-like protein 1 {ECO:0000303\|PubMed:16679453}
Gene Name	atl1 {ECO:0000303\|PubMed:16679453}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	108
Subcellular Localization
Protein Description	Involved in DNA damage recognition. Binds DNA containing O(6)-methylguanine and larger O(6)-alkylguanine adducts. The DNA is bent, the damaged base is rotated out of the DNA duplex into a hydrophobic binding pocket (nucleotide flipping), with Arg-39 donating a hydrogen bond to the orphaned cytosine to stabilize the extrahelical DNA conformation. This structural change in DNA presents the lesion to the nucleotide excision repair (NER) pathway. [PubMed: 16679453]
Protein Sequence	MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ATL1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ATL1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ATL1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ATL1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RAD14_SCHPO	rhp14	genetic	19516334
FEN1_SCHPO	rad2	genetic	19516334

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ATL1_SCHPO

Related Literatures of Post-Translational Modification