UniProt ID | YI81_SCHPO | |
---|---|---|
UniProt AC | Q9URW1 | |
Protein Name | UPF0321 protein PJ695.01c | |
Gene Name | SPAPJ695.01c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 117 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MLLLLYICCLFLKFILANVDLTFVEYAKLPSKYAELLANATNQQGVMLFSTGDIRIGAYNYLVNNVTEINNDTDAYLCQLLTGQYTTDCYIFDTNSDDKPETFNSSIHLLNSDLDPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | N-linked_Glycosylation | KYAELLANATNQQGV HHHHHHHHCCCCCCE | 47.47 | - | |
65 | N-linked_Glycosylation | AYNYLVNNVTEINND CEEEHHCCEEEECCC | 34.31 | - | |
71 | N-linked_Glycosylation | NNVTEINNDTDAYLC CCEEEECCCCHHHHH | 60.25 | - | |
104 | N-linked_Glycosylation | DDKPETFNSSIHLLN CCCCCCCHHHHHHHC | 42.12 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YI81_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YI81_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YI81_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YI81_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...