YI81_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YI81_SCHPO
• UniProt AC: Q9URW1
• Protein Name: UPF0321 protein PJ695.01c
• Gene Name: SPAPJ695.01c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 117
• Protein Sequence: MLLLLYICCLFLKFILANVDLTFVEYAKLPSKYAELLANATNQQGVMLFSTGDIRIGAYNYLVNNVTEINNDTDAYLCQLLTGQYTTDCYIFDTNSDDKPETFNSSIHLLNSDLDPK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	N-linked_Glycosylation	KYAELLANATNQQGV HHHHHHHHCCCCCCE	47.47	-
65	N-linked_Glycosylation	AYNYLVNNVTEINND CEEEHHCCEEEECCC	34.31	-
71	N-linked_Glycosylation	NNVTEINNDTDAYLC CCEEEECCCCHHHHH	60.25	-
104	N-linked_Glycosylation	DDKPETFNSSIHLLN CCCCCCCHHHHHHHC	42.12	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YI81_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YI81_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YI81_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YI81_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.