UniProt ID | PFL4_SCHPO | |
---|---|---|
UniProt AC | Q7Z9I1 | |
Protein Name | Putative cell agglutination protein pfl4 {ECO:0000305} | |
Gene Name | pfl4 {ECO:0000303|PubMed:23236291} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 609 | |
Subcellular Localization | Cell surface . | |
Protein Description | May be involved in agglutination during conjugation or other aspects of colony formation (By similarity). Induces flocculation when overexpressed. [PubMed: 23236291] | |
Protein Sequence | MLFLRFFIFTFFTSIFTVVVSEPPVSAKFAKRVLSATSSSSSTCPEFITIFSEGPSEYITTIYPSSKSSGRGTTNHSTIYTTINSGTVASTYTVTLADGDVVVKDIEPTAGTVTTTITSGSHEFTTTLAEASGTVPGTVEVVEPLAGTVTTTIHSGSVEYNTTLATASGTVPGTVEVVEPAVGTVTTTIYSGSEEFTTTLASASGSISGTVEVIEPTAGTVTTTIYSGDQEYTTILAEASGTVPGTVEVIEPAVGTVTTTTYSGSVEYTTTLVPASGSVSGTVEVVEPAVGTVTTTLQSGSQAFTTTVPASGSVSGTVEVVQPTGGTVTNTVYEGSQTITSTLATASGTVPGTVEVILPGPSTIYSGTVATTITYDVSSTPASTVVVIPTAVCNGERGLQYAVYNYDISSSKNQFCATSGVTDVSSFTQPAYFGSSDLDQSSPLFTGVLSSSDSVPQWTSSYNLPGYPPDATAMGSTSSACKVIVYQFFFRVPVTDTFSLDVTNVDDVFYGWFGDKAISGWSNTNYDTYAYWHATNGQTGIASFSMGSLTADTYVPVRFVVANGAGKGGFDFSFVDSEGNSYNPTSYAYTATCTESFLPFGQGNGGVDN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PFL4_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PFL4_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PFL4_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PFL9_SCHPO | pfl9 | genetic | 23236291 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...