UniProt ID | CSN7_SCHPO | |
---|---|---|
UniProt AC | Q9UUJ7 | |
Protein Name | COP9 signalosome complex subunit 7 | |
Gene Name | csn71 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 205 | |
Subcellular Localization | ||
Protein Description | Component of the COP9 signalosome (CSN) complex that acts as an regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes.. | |
Protein Sequence | MEEKISQAIDDPNVFCFQELWIECQEVQKSQPIDSAVLRTLEIFCRGDIRDASSEWNELRFKKLRLLTLIDLANRHVGSSVSFETILVHLQLDRLPPSDPTFTVEYYIMQAMMNQILVGKINAKTQTLHVSWALERFLDSKRIDEMKYSLDRFIERCSNILFQLDAGTPSVSKSFKRASRMSSSDGIDYMVFDKRPRPDDTDFDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
179 | Phosphorylation | SKSFKRASRMSSSDG CHHHHHHHHCCCCCC | 32.33 | 24763107 | |
182 | Phosphorylation | FKRASRMSSSDGIDY HHHHHHCCCCCCCCE | 26.11 | 24763107 | |
183 | Phosphorylation | KRASRMSSSDGIDYM HHHHHCCCCCCCCEE | 24.09 | 28889911 | |
184 | Phosphorylation | RASRMSSSDGIDYMV HHHHCCCCCCCCEEE | 32.33 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSN7_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSN7_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSN7_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NSE6_SCHPO | nse6 | genetic | 18931302 | |
MCL1_SCHPO | mcl1 | genetic | 18818364 | |
SGF29_SCHPO | sgf29 | genetic | 18818364 | |
IDHP_SCHPO | idp1 | genetic | 22681890 | |
MGR2_SCHPO | mgr2 | genetic | 22681890 | |
RAD55_SCHPO | rad55 | genetic | 22681890 | |
HRQ1_SCHPO | hrq1 | genetic | 22681890 | |
YE08_SCHPO | SPAC17H9.08 | genetic | 22681890 | |
PPR8_SCHPO | ppr8 | genetic | 22681890 | |
YJB1_SCHPO | dbl2 | genetic | 22681890 | |
RAD57_SCHPO | rad57 | genetic | 22681890 | |
LIZ1_SCHPO | liz1 | genetic | 22681890 | |
POF3_SCHPO | pof3 | genetic | 22681890 | |
ATP11_SCHPO | atp11 | genetic | 22681890 | |
ASK1_SCHPO | ask1 | genetic | 22681890 | |
TREA_SCHPO | ntp1 | genetic | 22681890 | |
MCL1_SCHPO | mcl1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...