YOG8_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YOG8_SCHPO
• UniProt AC: O74313
• Protein Name: Putative uncharacterized protein C15D4.08c
• Gene Name: SPBC15D4.08c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 138
• Protein Sequence: MPESAPSTPPSVNRRHEPEMLSEYPSLMFEHSYLASPSSPIDQVHDELKHSQKRPRLTNDEETIPEEDDSTVRLTDSELEDPVSSNELIQTSCHLLTSVLTQLQTNLDKLKDSHQKALLRIQELEKKVSELSKNNKDS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MPESAPSTPPS ----CCCCCCCCCCC	39.34	29996109
7	Phosphorylation	-MPESAPSTPPSVNR -CCCCCCCCCCCCCC	53.94	29996109
8	Phosphorylation	MPESAPSTPPSVNRR CCCCCCCCCCCCCCC	37.85	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YOG8_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YOG8_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YOG8_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YOG8_SCHPO	SPBC15D4.08c	physical	26771498
IMA2_SCHPO	imp1	physical	26771498
PIL1_SCHPO	pil1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.