UniProt ID | RRS1_SCHPO | |
---|---|---|
UniProt AC | O59678 | |
Protein Name | Ribosome biogenesis regulatory protein homolog | |
Gene Name | SPBC29A3.16 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 166 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Involved in ribosomal large subunit assembly.. | |
Protein Sequence | MSAQIENSIPLDFDLGNMAAFDISPLDETKLSGSEKESFLFSLSRDNVQQLVNKMISLPKERTSDGVLLQLPETVTPLPRAKPLPKPKPETKWQRFARIKGIAPKKREGRLVFDEASGEWVPKWGYKGKNKELETQWLVEEGEKEKKLTSKQVRNTSKKIKRSRRH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRS1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRS1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRS1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PP2C1_SCHPO | ptc1 | physical | 23695164 | |
PP2C1_SCHPO | ptc1 | physical | 26771498 | |
EBP2_SCHPO | ebp2 | physical | 26122634 | |
RPF2_SCHPO | SPAC926.08c | physical | 26122634 | |
EBP2_YEAST | EBP2 | physical | 26122634 | |
RPF2_YEAST | RPF2 | physical | 26122634 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...