| UniProt ID | ELP5_SCHPO | |
|---|---|---|
| UniProt AC | O94495 | |
| Protein Name | Elongator complex protein 5 | |
| Gene Name | iki1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 314 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Acts as component of the RNA polymerase II elongator complex, which is a major histone acetyltransferase component of the RNA polymerase II (RNAPII) holoenzyme and is involved in transcriptional elongation. May be involved in tRNA modification. Required for an early step in synthesis of 5-methoxycarbonylmethyl (mcm5) and 5-carbamoylmethyl (ncm5) groups present on uridines at the wobble position in tRNA (By similarity).. | |
| Protein Sequence | MSKFLLNRCIRDLSPLTVLKDNLQQTAKPILNYYAKNAASRGIKVLFISYETLEKEAPEGIDCFLYATSWEKVKSLKELYEHISSWRTQGKQHIVMIDTINPILNTSISSFTMFFGSVLALGSICFLTSFHKDVTLENYPSYLPPCEVFLDFTSTCTVSLIGMQHLSVEHDAKMRSLPNPLLEELQDDKIISLLGSNCETAIVLHVEFRKKSGRIIKESCVLKNGKLEPYTPFEETARGPEPADNQIDFNVSFNLNVSEKERKERDKVFLPYFSAQMVGSQHKSSFVDEGTIIYHADEADDFDEEEDADEDLLI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of ELP5_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ELP5_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ELP5_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ELP5_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ASK1_SCHPO | ask1 | genetic | 18818364 | |
| UDS1_SCHPO | uds1 | genetic | 18818364 | |
| EST1_SCHPO | est1 | genetic | 18818364 | |
| SWI3_SCHPO | swi3 | genetic | 18818364 | |
| HIR1_SCHPO | hip1 | genetic | 18818364 | |
| YJ03_SCHPO | rhn1 | genetic | 18818364 | |
| PLMT_SCHPO | cho1 | genetic | 18818364 | |
| SWD3_SCHPO | swd3 | genetic | 18818364 | |
| RSC1_SCHPO | rsc1 | genetic | 18818364 | |
| CLR3_SCHPO | clr3 | genetic | 18818364 | |
| HPC2_SCHPO | hip4 | genetic | 18818364 | |
| RIK1_SCHPO | rik1 | genetic | 18818364 | |
| ERS1_SCHPO | ers1 | genetic | 18818364 | |
| SET5_SCHPO | set5 | genetic | 18818364 | |
| DCR1_SCHPO | dcr1 | genetic | 18818364 | |
| YCO6_SCHPO | nap1 | genetic | 18818364 | |
| ARP6_SCHPO | arp6 | genetic | 18818364 | |
| VPH2_SCHPO | vph2 | genetic | 18818364 | |
| ALP14_SCHPO | alp14 | genetic | 18818364 | |
| RAF2_SCHPO | raf2 | genetic | 18818364 | |
| KU80_SCHPO | pku80 | genetic | 18818364 | |
| FFT2_SCHPO | fft2 | genetic | 18818364 | |
| CDS1_SCHPO | cds1 | genetic | 18818364 | |
| SKI3_SCHPO | SPCC1919.05 | genetic | 18818364 | |
| NOT2_SCHPO | not2 | genetic | 18818364 | |
| ELP6_SCHPO | elp6 | physical | 26771498 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...