| UniProt ID | YCO6_SCHPO | |
|---|---|---|
| UniProt AC | O59797 | |
| Protein Name | Putative nucleosome assembly protein C364.06 | |
| Gene Name | SPCC364.06 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 393 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | ||
| Protein Sequence | MVENVNINNKRAGKMSAAPTPHNTPSGTSAPNFGAKAPQVNTIDEGDENLEAIDGKLGSLLHLTSEGVSELPEAVQRRISGLRGLQKRYSDLESQFQKELFELEKAYAKKYAPIFKRRSEVVRGADEPTEEEIKKGEAADENEKKEPTSSESKKQEGGDDTKGIPEFWLTAMKNVLSLSEMITPEDEGALSHLVDIRISYMEKPGFKLEFEFAENPFFTNKILTKTYYYMEESGPSNVFLYDHAEGDKVDWKENADLTVRTVTKKQRNKNTKQTRVVKVSVPRDSFFNFFNPPTPPSEEDEESESPELDELLELDYQIGEDFKEKLIPRAVEWFTGEALALENYDGFSDLDVEEDEDDVESSSNEEVSDSDEEDSDSKHTAHGQQNAAECRQQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Phosphorylation | NKRAGKMSAAPTPHN CCCCCCCCCCCCCCC | 25.43 | 28889911 | |
| 20 | Phosphorylation | GKMSAAPTPHNTPSG CCCCCCCCCCCCCCC | 32.24 | 28889911 | |
| 24 | Phosphorylation | AAPTPHNTPSGTSAP CCCCCCCCCCCCCCC | 18.79 | 28889911 | |
| 26 | Phosphorylation | PTPHNTPSGTSAPNF CCCCCCCCCCCCCCC | 53.30 | 28889911 | |
| 28 | Phosphorylation | PHNTPSGTSAPNFGA CCCCCCCCCCCCCCC | 26.50 | 25720772 | |
| 29 | Phosphorylation | HNTPSGTSAPNFGAK CCCCCCCCCCCCCCC | 45.30 | 28889911 | |
| 59 | Phosphorylation | AIDGKLGSLLHLTSE HHCCHHHHHHHHHCC | 37.89 | 28889911 | |
| 64 | Phosphorylation | LGSLLHLTSEGVSEL HHHHHHHHCCCHHHC | 17.62 | 25720772 | |
| 65 | Phosphorylation | GSLLHLTSEGVSELP HHHHHHHCCCHHHCH | 38.42 | 29996109 | |
| 90 | Phosphorylation | RGLQKRYSDLESQFQ HHHHHHHHHHHHHHH | 39.49 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YCO6_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YCO6_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YCO6_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...