UniProt ID | YCO6_SCHPO | |
---|---|---|
UniProt AC | O59797 | |
Protein Name | Putative nucleosome assembly protein C364.06 | |
Gene Name | SPCC364.06 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 393 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MVENVNINNKRAGKMSAAPTPHNTPSGTSAPNFGAKAPQVNTIDEGDENLEAIDGKLGSLLHLTSEGVSELPEAVQRRISGLRGLQKRYSDLESQFQKELFELEKAYAKKYAPIFKRRSEVVRGADEPTEEEIKKGEAADENEKKEPTSSESKKQEGGDDTKGIPEFWLTAMKNVLSLSEMITPEDEGALSHLVDIRISYMEKPGFKLEFEFAENPFFTNKILTKTYYYMEESGPSNVFLYDHAEGDKVDWKENADLTVRTVTKKQRNKNTKQTRVVKVSVPRDSFFNFFNPPTPPSEEDEESESPELDELLELDYQIGEDFKEKLIPRAVEWFTGEALALENYDGFSDLDVEEDEDDVESSSNEEVSDSDEEDSDSKHTAHGQQNAAECRQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | NKRAGKMSAAPTPHN CCCCCCCCCCCCCCC | 25.43 | 28889911 | |
20 | Phosphorylation | GKMSAAPTPHNTPSG CCCCCCCCCCCCCCC | 32.24 | 28889911 | |
24 | Phosphorylation | AAPTPHNTPSGTSAP CCCCCCCCCCCCCCC | 18.79 | 28889911 | |
26 | Phosphorylation | PTPHNTPSGTSAPNF CCCCCCCCCCCCCCC | 53.30 | 28889911 | |
28 | Phosphorylation | PHNTPSGTSAPNFGA CCCCCCCCCCCCCCC | 26.50 | 25720772 | |
29 | Phosphorylation | HNTPSGTSAPNFGAK CCCCCCCCCCCCCCC | 45.30 | 28889911 | |
59 | Phosphorylation | AIDGKLGSLLHLTSE HHCCHHHHHHHHHCC | 37.89 | 28889911 | |
64 | Phosphorylation | LGSLLHLTSEGVSEL HHHHHHHHCCCHHHC | 17.62 | 25720772 | |
65 | Phosphorylation | GSLLHLTSEGVSELP HHHHHHHCCCHHHCH | 38.42 | 29996109 | |
90 | Phosphorylation | RGLQKRYSDLESQFQ HHHHHHHHHHHHHHH | 39.49 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YCO6_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YCO6_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YCO6_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...