dbPTM

RL24B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RL24B_SCHPO
UniProt AC	O74884
Protein Name	60S ribosomal protein L24-B
Gene Name	rpl2402
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	149
Subcellular Localization
Protein Description
Protein Sequence	MKVEVCSFSGSKVYPGAGRLFVRGDNKVFRFVNKKSESLFLQRKNPRRLSWTVLYRRMHKKGISEEHAKKRTRRTVKHQRGIVGANLDVIKEKRNQRPEVRAAARAAALKQRKDKRAASESEKKAIKAKSAASSARGQAIKNAKVAARR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MKVEVCSFSGSKVY -CCEEEECCCCCEEC	27.85	29996109
9	Phosphorylation	KVEVCSFSGSKVYPG CEEEECCCCCEECCC	26.34	29996109
11	Phosphorylation	EVCSFSGSKVYPGAG EEECCCCCEECCCCC	20.11	29996109
36	Phosphorylation	FRFVNKKSESLFLQR EEEECCCCCCCCCCC	33.74	28889911
38	Phosphorylation	FVNKKSESLFLQRKN EECCCCCCCCCCCCC	31.35	25720772
50	Phosphorylation	RKNPRRLSWTVLYRR CCCCCCCHHHHHHHH	20.91	28889911
119	Phosphorylation	RKDKRAASESEKKAI HHHHHHCCHHHHHHH	40.44	28889911
121	Phosphorylation	DKRAASESEKKAIKA HHHHCCHHHHHHHHH	52.82	28889911
130	Phosphorylation	KKAIKAKSAASSARG HHHHHHHHHHHHHHH	33.65	24763107
133	Phosphorylation	IKAKSAASSARGQAI HHHHHHHHHHHHHHH	25.01	21712547
134	Phosphorylation	KAKSAASSARGQAIK HHHHHHHHHHHHHHH	19.77	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RL24B_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RL24B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RL24B_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CLR3_SCHPO	clr3	genetic	19547744

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RL24B_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50, AND MASSSPECTROMETRY.	18257517 [Abstract]