RL24A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL24A_SCHPO
• UniProt AC: Q92354
• Protein Name: 60S ribosomal protein L24-A
• Gene Name: rpl2401
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 149
• Protein Sequence: MKVEVCSFSGSKVYPGAGRLFVRGDNKVFRFVNKKSESLFLQRKNPRRLSWTVLYRRMHKKGISEEHAKKRTRRTVKHQRGIVGANLDVIKEKRNQRPEVRAAARAAALKQRKDKKAASESEKKAIKAKSAASSARGQAIKNAKAAARH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MKVEVCSFSGSKVY -CCEEEECCCCCCCC	27.85	29996109
9	Phosphorylation	KVEVCSFSGSKVYPG CEEEECCCCCCCCCC	26.34	29996109
11	Phosphorylation	EVCSFSGSKVYPGAG EEECCCCCCCCCCCC	20.11	29996109
36	Phosphorylation	FRFVNKKSESLFLQR EEEECCCCCCCCCCC	33.74	28889911
38	Phosphorylation	FVNKKSESLFLQRKN EECCCCCCCCCCCCC	31.35	25720772
50	Phosphorylation	RKNPRRLSWTVLYRR CCCCCCCHHHHHHHH	20.91	28889911
130	Phosphorylation	KKAIKAKSAASSARG HHHHHHHHHHHHHHH	33.65	24763107
133	Phosphorylation	IKAKSAASSARGQAI HHHHHHHHHHHHHHH	25.01	21712547
134	Phosphorylation	KAKSAASSARGQAIK HHHHHHHHHHHHHHH	19.77	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL24A_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL24A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL24A_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RL24A_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.