UniProt ID | YDX1_SCHPO | |
---|---|---|
UniProt AC | O14165 | |
Protein Name | Uncharacterized protein C4C5.01 | |
Gene Name | SPAC4C5.01 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 249 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAAKHVKYMACLFDMDGLLVDSETIYTKTTNLILDRYGKDPLPISVKAQMMGRPGSAAAKVVIDWSNIPMTPQQFVDEQQVIRAKFWSSLKPMPGAESLINNLSNHGIDIGLATSSNTANYNMKTAHLKHIFEKFGKNVITGDNPSIAPGRGKPFPDIWLKVLNLINESRKQRGLKALTPSQCIAFEDSIPGVKSAKAAGMHVIWVPDAAIKNLVGDQLNEIVDSQCETLPSLSEFDINKYLNINSKQA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YDX1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YDX1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YDX1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YDX1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YKW2_SCHPO | SPAP32A8.02 | genetic | 22681890 | |
LCMT1_SCHPO | ppm1 | genetic | 22681890 | |
YN8E_SCHPO | SPBP35G2.14 | genetic | 22681890 | |
HEM2_SCHPO | hem2 | genetic | 22681890 | |
DAD1_SCHPO | dad1 | genetic | 22681890 | |
PPR2_SCHPO | ppr2 | genetic | 22681890 | |
EXO1_SCHPO | exo1 | genetic | 22681890 | |
YIV5_SCHPO | SPAC144.05 | genetic | 22681890 | |
GBB_SCHPO | git5 | genetic | 22681890 | |
SET2_SCHPO | set2 | genetic | 22681890 | |
VPS38_SCHPO | vps38 | genetic | 22681890 | |
YCO6_SCHPO | nap1 | genetic | 22681890 | |
YLM6_SCHPO | SPAC19B12.06c | genetic | 22681890 | |
RL16B_SCHPO | rpl1601 | genetic | 22681890 | |
TOM70_SCHPO | tom70 | genetic | 22681890 | |
FFT3_SCHPO | fft3 | genetic | 22681890 | |
YCG6_SCHPO | pus3 | genetic | 22681890 | |
TCP4_SCHPO | sub1 | genetic | 22681890 | |
PVH1_SCHPO | SPBC17A3.06 | genetic | 22681890 | |
YLF7_SCHPO | SPAC30C2.07 | genetic | 22681890 | |
YKEE_SCHPO | SPAC1805.14 | genetic | 22681890 | |
YDA3_SCHPO | SPAC1F12.03c | genetic | 22681890 | |
OXDA_SCHPO | dao1 | genetic | 22681890 | |
MUG73_SCHPO | mug73 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...