TCP4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TCP4_SCHPO
• UniProt AC: P87294
• Protein Name: Putative RNA polymerase II transcriptional coactivator
• Gene Name: SPAC16A10.02
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 136
• Subcellular Localization: Nucleus.
• Protein Description: General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. Binds single-stranded DNA (By similarity)..
• Protein Sequence: MAGKRVIASGDKASSKKPKTEKQSDHELHWALNETEKKRITLSEFRGTRYVHIREYYEKDGDMLPGKKGIALNINEWKKLKQLIHEVDDSLGLVDSGSDSEDEIKEKAENNASLKNDEDDLNTKTENKTDDSSVEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
90	Phosphorylation	LIHEVDDSLGLVDSG HHHHHHHHCCCCCCC	21.63	21712547
96	Phosphorylation	DSLGLVDSGSDSEDE HHCCCCCCCCCCHHH	32.49	28889911
98	Phosphorylation	LGLVDSGSDSEDEIK CCCCCCCCCCHHHHH	41.75	28889911
100	Phosphorylation	LVDSGSDSEDEIKEK CCCCCCCCHHHHHHH	48.95	24763107
113	Phosphorylation	EKAENNASLKNDEDD HHHHHCCCCCCCHHH	41.84	21712547
129	Phosphorylation	NTKTENKTDDSSVEN HHCCCCCCCCCCCCC	57.53	21712547
132	Phosphorylation	TENKTDDSSVEN--- CCCCCCCCCCCC---	38.81	21712547
133	Phosphorylation	ENKTDDSSVEN---- CCCCCCCCCCC----	40.21	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TCP4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TCP4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TCP4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TOP1_SCHPO	top1	genetic	18818364
RYH1_SCHPO	ryh1	genetic	18818364
EIF2A_SCHPO	SPBC4B4.04	genetic	18818364
HRR1_SCHPO	hrr1	genetic	18818364
DCR1_SCHPO	dcr1	genetic	18818364
RAF1_SCHPO	raf1	genetic	18818364
ASL1_SCHPO	asl1	genetic	22681890
YDX1_SCHPO	SPAC4C5.01	genetic	22681890
LUB1_SCHPO	lub1	genetic	22681890
LDH_SCHPO	SPAC186.08c	genetic	22681890
ALG9_SCHPO	alg9	genetic	22681890
MUG80_SCHPO	mug80	genetic	22681890
ATP11_SCHPO	atp11	genetic	22681890
PRZ1_SCHPO	prz1	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of fission yeast.";
Wilson-Grady J.T., Villen J., Gygi S.P.;
J. Proteome Res. 7:1088-1097(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96 AND SER-98, AND MASSSPECTROMETRY.
PubMed: 18257517