UniProt ID | ERI1_SCHPO | |
---|---|---|
UniProt AC | Q08I43 | |
Protein Name | 3'-5' exonuclease eri1 | |
Gene Name | eri1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 313 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | RNA exonuclease that acts as a negative regulator of RNA interference (RNAi). Acts by degrading the 3'-overhangs of double-stranded short interfering RNAs (siRNAs). Represses the accumulation of heterochromatic siRNAs leading to negative regulation of the RNAi-mediated heterochromoatin assembly. Also involved in rRNA biogenesis, trimming the 5.8S ribosomal RNA (rRNA) from a slightly longer pre-5.8S RNA in the cytoplasm.. | |
Protein Sequence | MESPVQILVWPFPCDEMNQKTPSTVEEIRIALQELGLSTNGNKEKLKRRWKFREKRLEEKRKQERYQKFSTSNENKTCLRYLLIVDVEATCEEGCGFSFENEIIELPCLLFDLIEKSIIDEFHSYVRPSMNPTLSDYCKSLTGIQQCTVDKAPIFSDVLEELFIFLRKHSNILVPSVDEIEIIEPLKSVPRTQPKNWAWACDGPWDMASFLAKQFKYDKMPIPDWIKGPFVDIRSFYKDVYRVPRTNINGMLEHWGLQFEGSEHRGIDDARNLSRIVKKMCSENVEFECNRWWMEYEKNGWIPNRSYPPYFAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ERI1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERI1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERI1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERI1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
REB1_SCHPO | reb1 | genetic | 22681890 | |
SWR1_SCHPO | swr1 | genetic | 22681890 | |
YEG5_SCHPO | mga2 | genetic | 22681890 | |
PFD5_SCHPO | bob1 | genetic | 22681890 | |
DBR1_SCHPO | dbr1 | genetic | 22681890 | |
YIQ4_SCHPO | SPAC824.04 | genetic | 22681890 | |
YLO2_SCHPO | tma23 | genetic | 22681890 | |
PAB2_SCHPO | pab2 | genetic | 22681890 | |
SWC3_SCHPO | swc3 | genetic | 22681890 | |
PHD1_SCHPO | hos2 | genetic | 22681890 | |
SET3_SCHPO | set3 | genetic | 22681890 | |
MSC1_SCHPO | msc1 | genetic | 22681890 | |
ASH2_SCHPO | ash2 | genetic | 22681890 | |
SNT2_SCHPO | snt2 | genetic | 22681890 | |
YCO6_SCHPO | nap1 | genetic | 22681890 | |
TOM70_SCHPO | tom70 | genetic | 22681890 | |
YQ9A_SCHPO | SPCC18.10 | genetic | 22681890 | |
FFT3_SCHPO | fft3 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...