UniProt ID | YLO2_SCHPO | |
---|---|---|
UniProt AC | Q9UUK4 | |
Protein Name | Uncharacterized protein C1952.02 | |
Gene Name | SPAC1952.02 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 202 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | ||
Protein Sequence | MFSSKRYLNSFGWEEGNALKEGGLTKPILTSRKYNTHGLGAKHDIADQWWDNVFSAQLQSIQVNTDNGKVAVQSNGVSTKLRMAKYHSKYSALSSVFRYAGRLCGTFEEDLVDKSLDSSVSPVSSKKVKVRKTSGKESSKREKSKKKKEKKEKKDKLKKKSKRLKLDDSHTQKRKRKVRDKESKKSSKSGLKKVSGTKKVKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
118 | Phosphorylation | LVDKSLDSSVSPVSS HHCCCCCCCCCCCCC | 37.62 | 25720772 | |
119 | Phosphorylation | VDKSLDSSVSPVSSK HCCCCCCCCCCCCCC | 26.70 | 29996109 | |
121 | Phosphorylation | KSLDSSVSPVSSKKV CCCCCCCCCCCCCCE | 22.87 | 28889911 | |
124 | Phosphorylation | DSSVSPVSSKKVKVR CCCCCCCCCCCEEEE | 39.56 | 29996109 | |
125 | Phosphorylation | SSVSPVSSKKVKVRK CCCCCCCCCCEEEEE | 36.41 | 24763107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YLO2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YLO2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YLO2_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...