RL27A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL27A_SCHPO
• UniProt AC: O14388
• Protein Name: 60S ribosomal protein L27-A
• Gene Name: rpl2701
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 136
• Protein Sequence: MVKILKPGKVALITRGRFAGKKVVILQAIDQGSKSHPFGHAVVAGVERYPLKVTKSMGAKRIARRSRVKPFIKVVNYNHLMPTRYALELDNLKGLITADTFKEPTQRSAARKTVKKTFEEKYQSGKSAWFFTPLRF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
33	Phosphorylation	LQAIDQGSKSHPFGH EEEECCCCCCCCCCC	25.92	25720772
35	Phosphorylation	AIDQGSKSHPFGHAV EECCCCCCCCCCCEE	37.78	21712547
85	Phosphorylation	NHLMPTRYALELDNL CCCCCCEEEEHHHCC	20.30	25720772
127	Phosphorylation	EKYQSGKSAWFFTPL HHHHCCCCEEEEEEC	33.97	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL27A_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL27A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL27A_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RL27A_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.