| UniProt ID | ENOPH_SCHPO | |
|---|---|---|
| UniProt AC | Q9P6Q2 | |
| Protein Name | Enolase-phosphatase E1 {ECO:0000255|HAMAP-Rule:MF_03117} | |
| Gene Name | utr4 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 216 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).. | |
| Protein Sequence | MVKNLLLDIEGTVGSISFVKDKLFPYAASRYESYVNENYESDENLRELGKTPEEALINLRKLHAEGSKERSFKMVQGRIWKKGYESNELTSHLFPDVVPAIQRSLQLGMRVYIYSSGSVPAQKLYFEHSDAGNLLKYFSGYYDTTIGLKTECGSYVKIVGNSNPREWLFLSDNINELKAARKVGLHTGLVVRPGNDPVVDTSGFPVYNSFEILFTE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of ENOPH_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ENOPH_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ENOPH_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ENOPH_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VPS71_SCHPO | vps71 | genetic | 18818364 | |
| HRP3_SCHPO | hrp3 | genetic | 22681890 | |
| SDS23_SCHPO | sds23 | genetic | 22681890 | |
| 6PGL_SCHPO | SPCC16C4.10 | genetic | 22681890 | |
| YLO2_SCHPO | tma23 | genetic | 22681890 | |
| ULP2_SCHPO | ulp2 | genetic | 22681890 | |
| YE08_SCHPO | SPAC17H9.08 | genetic | 22681890 | |
| ARP42_SCHPO | arp42 | genetic | 22681890 | |
| MU183_SCHPO | mug183 | genetic | 22681890 | |
| HOP1_SCHPO | hop1 | genetic | 22681890 | |
| SPN1_SCHPO | spn1 | genetic | 22681890 | |
| ENOPH_SCHPO | SPAC644.08 | physical | 26771498 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
