UniProt ID | ENOPH_SCHPO | |
---|---|---|
UniProt AC | Q9P6Q2 | |
Protein Name | Enolase-phosphatase E1 {ECO:0000255|HAMAP-Rule:MF_03117} | |
Gene Name | utr4 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 216 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).. | |
Protein Sequence | MVKNLLLDIEGTVGSISFVKDKLFPYAASRYESYVNENYESDENLRELGKTPEEALINLRKLHAEGSKERSFKMVQGRIWKKGYESNELTSHLFPDVVPAIQRSLQLGMRVYIYSSGSVPAQKLYFEHSDAGNLLKYFSGYYDTTIGLKTECGSYVKIVGNSNPREWLFLSDNINELKAARKVGLHTGLVVRPGNDPVVDTSGFPVYNSFEILFTE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ENOPH_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ENOPH_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ENOPH_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ENOPH_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VPS71_SCHPO | vps71 | genetic | 18818364 | |
HRP3_SCHPO | hrp3 | genetic | 22681890 | |
SDS23_SCHPO | sds23 | genetic | 22681890 | |
6PGL_SCHPO | SPCC16C4.10 | genetic | 22681890 | |
YLO2_SCHPO | tma23 | genetic | 22681890 | |
ULP2_SCHPO | ulp2 | genetic | 22681890 | |
YE08_SCHPO | SPAC17H9.08 | genetic | 22681890 | |
ARP42_SCHPO | arp42 | genetic | 22681890 | |
MU183_SCHPO | mug183 | genetic | 22681890 | |
HOP1_SCHPO | hop1 | genetic | 22681890 | |
SPN1_SCHPO | spn1 | genetic | 22681890 | |
ENOPH_SCHPO | SPAC644.08 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...