UniProt ID | MU183_SCHPO | |
---|---|---|
UniProt AC | Q92348 | |
Protein Name | Meiotically up-regulated gene 183 protein | |
Gene Name | mug183 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 376 | |
Subcellular Localization | ||
Protein Description | Has a role in meiosis.. | |
Protein Sequence | MESNVNDEIEKAFAKDSELAKDIIKQYGKTKSIQPLVHRICKYINTLQKENESGQVKEAGSLKRKDRVQHELGQLVYGVLNLSFQAPMRKKLDVYIYENGIAVTLPGEPNLIEFWLPWNEIRCAIHVPCPRKANVQNNFVIILKSESSAENIVSSDNVKEPVFFTAPYPLKKLNLVEGLRSFTHCTNSWDIFRDYFEFIGTSTLSPSVEEFVCPNPQTGDNGTTYGVEANYKAKDGHLFFLRTGILWGFRKPILFIELASIQHFSYSNVLQRTFTVNFEAGGTIYSFDMVDQSVFRAVNDYATKHGLMDSSLAEEKAAPVPKNPSVSYLNEASSLENVDDMDDIDVKEPLFSDNDEDVENSDSEDGSESIGSEDEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MU183_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MU183_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MU183_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MU183_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DSC1_SCHPO | dsc1 | genetic | 18818364 | |
HRR1_SCHPO | hrr1 | genetic | 18818364 | |
BMT5_SCHPO | SPCC1919.13c | genetic | 18818364 | |
ABP1_SCHPO | cbp1 | genetic | 18818364 | |
PDP1_SCHPO | pdp1 | genetic | 18818364 | |
YCJ3_SCHPO | SPCC63.03 | genetic | 22681890 | |
ENOPH_SCHPO | SPAC644.08 | genetic | 22681890 | |
ARP6_SCHPO | arp6 | genetic | 22681890 | |
DBR1_SCHPO | dbr1 | genetic | 22681890 | |
RPA12_SCHPO | rpa12 | genetic | 22681890 | |
YGWH_SCHPO | gmh4 | genetic | 22681890 | |
HMT2_SCHPO | hmt2 | genetic | 22681890 | |
HUS1_SCHPO | hus1 | genetic | 22681890 | |
PDS5_SCHPO | pds5 | genetic | 22681890 | |
RL16B_SCHPO | rpl1601 | genetic | 22681890 | |
IWR1_SCHPO | iwr1 | genetic | 22681890 | |
ARC1_SCHPO | SPAC30C2.04 | genetic | 22681890 | |
YKEE_SCHPO | SPAC1805.14 | genetic | 22681890 | |
RCD1_SCHPO | rcd1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...