UniProt ID | ARC1_SCHPO | |
---|---|---|
UniProt AC | Q9P6K7 | |
Protein Name | tRNA-aminoacylation cofactor arc1 | |
Gene Name | SPAC30C2.04 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 450 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Binds to tRNA and functions as a cofactor for the methionyl-tRNA synthetase (MetRS) and glutamyl-tRNA synthetase (GluRS). Forms a complex with MetRS and GluRS and increases their affinity for cognate tRNAs due to the presence of a tRNA binding domain in its middle and C-terminal part (By similarity).. | |
Protein Sequence | MSFLWAKEFCVLKYPYKLFITHKFSYLLRFETVTLNNIRSPQFYAKLTFSHHQPTVSGTMSTELKFISKYLQISIPETKEGPVSSLFKAVSEQKPELLGNTDFEKAQILEWTTKAFSPIETQSIVEQLDEFLKSSTFIAQDSGISVADLAVYARIHSYICGLSAKEGYKLNNVCRWFDFIQHQESVMEAANSMSMKLANIDLNAPKIQRPSVIKKDKKEKKEGKPSQEASVKSVEKAPKGLEGAKKEKQNKKEKKDKKDKKDKKEKAPKEPPKAATPVPSMIDFRIGFIEKAVKHPNADSLYVSTIHCGDAEGPRTVCSGLVKYIPLEQMQQRKVIVVANLKPVNMRSVKSQAMVFCASSPDKSVVEFVLPPENAEIGDRLTFEGFDTEEPEAQLNPKRKIWEAIQPGFTSGEDLICGYKDESGLHRLFVKGKKDLGFCKAQTVVNGTLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
276 | Phosphorylation | KEPPKAATPVPSMID CCCCCCCCCCCCHHH | 28889911 | ||
359 | Phosphorylation | QAMVFCASSPDKSVV CEEEEECCCCCCCEE | 29996109 | ||
360 | Phosphorylation | AMVFCASSPDKSVVE EEEEECCCCCCCEEE | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARC1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARC1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARC1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARC1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...