UniProt ID | MEX67_SCHPO | |
---|---|---|
UniProt AC | Q9Y8G3 | |
Protein Name | mRNA export factor mex67 | |
Gene Name | mex67 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 596 | |
Subcellular Localization | Nucleus . Cytoplasm . Localizes at both the nuclear and cytoplasmic site of the pores (PubMed:14963046). Shuttles between the nucleus and the cytoplasm (PubMed:14963046). | |
Protein Description | Involved in the export of mRNA from the nucleus to the cytoplasm.. | |
Protein Sequence | MLRRKRERRNAVKENEMVIDTPLEKRRTPGKPRATREPPISVVITGHSKGSEDDLISFVWRKVKVRLMNISYSPASVTAVVKSQDFSRLNGLNGAAFAGDHLAIRRVDGASNVTQDYRKAKTKRSFRSVSAPSLSALATQAQRNVSKTLPQSTNETIEKLRQFLQTRYQPATKFLDLGNLQQDPLLKQMGILAEASTKSKMFPALMKVASLNFPDVISVSLSDNNLQSVTAVTTLAQTWPKLLNLSLANNRITSLSDLDPWSPKTKLPELQELVLVGNPIVTTFANRAMDYQREMVSRFPKLRLLDGNSINSEIIASQSTVPFPVYQSFFDKVETEQIVNSFLAAFFKGWDENRSALVNQLYSPNATFSISLNASNVRTNFSQKTDTKKWGAYKMKSRNLLYSQSQKESKSRLFNGHEEISNAVKSLPATAHDLSDRSQWVFDGWNLVLPSVGAAIKIVVHGQFEEPQNKRLLRSFDRTLLILPGGSTGILIINDLLVIRSFAGSLGWLPGQSSVRTSNNAMSASASKPSDIVQPRPEQAMLDTRQQIVLKIKAETGLNDYYAHMCCEQNNWDYNSALASFLELKSRNVIPAEAFS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
128 | Phosphorylation | KTKRSFRSVSAPSLS HCHHCHHCCCHHHHH | 20.58 | 28889911 | |
130 | Phosphorylation | KRSFRSVSAPSLSAL HHCHHCCCHHHHHHH | 35.39 | 28889911 | |
133 | Phosphorylation | FRSVSAPSLSALATQ HHCCCHHHHHHHHHH | 34.37 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MEX67_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MEX67_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MEX67_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ELF1_SCHPO | elf1 | genetic | 12110682 | |
RAE1_SCHPO | rae1 | genetic | 12110682 | |
RAE1_SCHPO | rae1 | genetic | 11073978 | |
NU184_SCHPO | nup184 | genetic | 11073978 | |
NP106_SCHPO | npp106 | genetic | 11073978 | |
RSM1_SCHPO | rsm1 | genetic | 15357289 | |
RAE1_SCHPO | rae1 | physical | 11073978 | |
MLO3_SCHPO | mlo3 | physical | 15990877 | |
PST2_SCHPO | pst2 | genetic | 19547744 | |
IPO11_HUMAN | IPO11 | physical | 21965294 | |
IMPA1_HUMAN | IMPA1 | physical | 21965294 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...