| UniProt ID | MLO3_SCHPO | |
|---|---|---|
| UniProt AC | Q09330 | |
| Protein Name | mRNA export protein mlo3 | |
| Gene Name | mlo3 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 199 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Has a role in the mRNA export process. Interferes with mitotic chromosome segregation when overexpressed.. | |
| Protein Sequence | MSMELDQSLDAIIASKPKGGIRKRRARSNKPKPTKNAKPAVNTASALKSVISEESKIIVSNLPTDVTEAQVKELFVKSIGPCKRVSLAYGPNGRSKGIATIIFSRPGDATRAYEQYEGRLVDGTRKMKVEIILDPSRQLNSLAARVSPASNASATASKNGAKSSKRKTTRRRRTPNRPKKSAEELDKEMDDYFGSNEKE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSMELDQSL ------CCCCHHHHH | 22.44 | 21712547 | |
| 8 | Phosphorylation | MSMELDQSLDAIIAS CCCCHHHHHHHHHHC | 28.08 | 21712547 | |
| 43 | Phosphorylation | NAKPAVNTASALKSV CCCCCCCHHHHHHHH | 18.52 | 25720772 | |
| 49 | Phosphorylation | NTASALKSVISEESK CHHHHHHHHHCCCCC | 26.07 | 25720772 | |
| 86 | Phosphorylation | IGPCKRVSLAYGPNG CCCCCEEEEEECCCC | 16.00 | 28889911 | |
| 147 | Phosphorylation | NSLAARVSPASNASA HHHHHHCCCCCCHHH | 14.81 | 25720772 | |
| 150 | Phosphorylation | AARVSPASNASATAS HHHCCCCCCHHHHHC | 35.99 | 25720772 | |
| 153 | Phosphorylation | VSPASNASATASKNG CCCCCCHHHHHCCCC | 30.33 | 25720772 | |
| 195 | Phosphorylation | EMDDYFGSNEKE--- HHHHHCCCCCCC--- | 31.73 | 24763107 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MLO3_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MLO3_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MLO3_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
