BRX1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BRX1_SCHPO
• UniProt AC: Q9HGL6
• Protein Name: Ribosome biogenesis protein brx1
• Gene Name: brx1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 295
• Subcellular Localization: Nucleus, nucleolus . Cytoplasm .
• Protein Description: Required for biogenesis of the 60S ribosomal subunit..
• Protein Sequence: MSTVYKLKTSERAPKNEDEDEEYVPVQNGQGNKHSAGFVPIKQKVLVLSSRGVTYRQRHLLNDLVSMMPHSKKDSKLDSKDRLYQLNELAELYNCNNIFFFESRRREDLYLHIARAPNGPTVKFHVENLHTMDELNMTGNALKGSRPILSFDKTFDTAPHLKVVKELLQQTFGIPKGARRSKPFIDRVCTLTIADGKIWFRNYEIRENEDKSKDPVTLIEIGPRFVMTIINILEGSFGGPVIYKNDTFVSSTMVRAAIRNQAAQRYVNRQESKLERQVRAQQNVIPEDPLDNVFA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
181	Phosphorylation	IPKGARRSKPFIDRV CCCCCCCCCCCCCEE	38.84	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BRX1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BRX1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BRX1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EBP2_SCHPO	ebp2	physical	26122634

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.