UniProt ID | RAE1_SCHPO | |
---|---|---|
UniProt AC | P41838 | |
Protein Name | Poly(A)+ RNA export protein | |
Gene Name | rae1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 352 | |
Subcellular Localization | Nucleus . Nuclear periphery. | |
Protein Description | Required for mitotic cell growth as well as for spore germination. Functions in cell cycle progression through trafficking of proteins required for mitosis. Has a role in the mRNA export process.. | |
Protein Sequence | MSLFGQATTSTVSNATGDLKKDVEVAQPPEDSISDLAFSPQAEYLAASSWDSKVRIYEVQATGQSIGKALYEHQGPVLSVNWSRDGTKVASGSVDKSAKVFDIQTGQNQQVAAHDDAVRCVRFVEAMGTSPILATGSWDKTLKYWDLRQSTPIATVSLPERVYAMDCVHPLLTVATAERNICVINLSEPTKIFKLAMSPLKFQTRSLACFIKGDGYAIGSVEGRCAIQNIDEKNASQNFSFRCHRNQAGNSADVYSVNSIAFHPQYGTFSTAGSDGTFSFWDKDSHQRLKSYPNVGGTISCSTFNRTGDIFAYAISYDWSKGYTFNNAQLPNKIMLHPVPQDEIKPRPKKGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of RAE1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAE1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAE1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAE1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PABP_SCHPO | pabp | genetic | 12112233 | |
ELF1_SCHPO | elf1 | genetic | 12110682 | |
MEX67_SCHPO | mex67 | genetic | 12110682 | |
NP106_SCHPO | npp106 | genetic | 9372936 | |
NU184_SCHPO | nup184 | genetic | 11073978 | |
MEX67_SCHPO | mex67 | genetic | 11073978 | |
NU184_SCHPO | nup184 | genetic | 12181330 | |
PABPX_SCHPO | crp79 | genetic | 12181330 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...