dbPTM

HAS1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HAS1_SCHPO
UniProt AC	Q09916
Protein Name	ATP-dependent RNA helicase has1
Gene Name	has1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	578
Subcellular Localization	Nucleus, nucleolus.
Protein Description	ATP-dependent RNA helicase involved in 40S ribosomal subunit biogenesis. Required for the processing and cleavage of 35S pre-rRNA at sites A0, A1, and A2, leading to mature 18S rRNA..
Protein Sequence	MAKSELKRKKHQSGNEEVKEKRQKPLKNDKKIAEELPQDEDDYEQEEENEDADQNTSVESESEELDNENEDERVQKSVNLNASSTSDIEKFSDLQLSENIQKAIKEMGFETMTEIQKRSIPPLLAGRDVLGAAKTGSGKTLAFLIPTIEMLYALKFKPRNGTGVIIISPTRELALQIFGVAKELLKYHHQTFGIVIGGANRRAEADKLVKGVNLLVATPGRLLDHLQNTKGFVFRNLRSLVIDEADRILEIGFEDEMRQIMKILPSENRQTLLFSATQTTKVEDLARISLKPGPLYVNVDSGKPTSTVEGLEQGYVVVDSDKRFLLLFSFLKRNLKKKVIVFMSSCASVKYMAELLNYIDLPVLDLHGKQKQQRRTNTFFEFCNAEKGILLCTNVAARGLDIPAVDWIVQYDPPDDPRDYIHRVGRTARGTKGTGKSLMFLAPSELGFLRYLKTAKVSLNEFEFPANKVANVQSQLEKLVSKNYYLQQSAKDGYRSYLQAYASYSLKSIFDINKLDLAKVAKSFGFAHPPNVNITIGASGRTDKKERRAGYNKKNHVDVYSKQRSSAISQDKERGWSR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
57	Phosphorylation	EDADQNTSVESESEE CCCCCCCCCHHHHHH	31.28	27738172
60	Phosphorylation	DQNTSVESESEELDN CCCCCCHHHHHHHCC	44.24	28889911
62	Phosphorylation	NTSVESESEELDNEN CCCCHHHHHHHCCCC	45.72	28889911
437	Phosphorylation	GTKGTGKSLMFLAPS CCCCCCCCEEEECHH	26.81	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HAS1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HAS1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HAS1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of HAS1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HAS1_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 AND SER-62, AND MASSSPECTROMETRY.	18257517 [Abstract]