UniProt ID | YCDA_SCHPO | |
---|---|---|
UniProt AC | O94549 | |
Protein Name | UPF0619 GPI-anchored membrane protein C1322.10 | |
Gene Name | SPCC1322.10 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 262 | |
Subcellular Localization |
Golgi apparatus membrane Lipid-anchor, GPI-anchor. Cell membrane Lipid-anchor, GPI-anchor . |
|
Protein Description | ||
Protein Sequence | MLARVGTTLFFLANALAAYAVSVTSPTRDTTWQSGQVNTVTWSSVSTDPEEMVIMLVNNAHYPNQNFNLGTVQSSAGSLDTDISISSDLPTDGWQIYFNGATSQNQGSLAQSEQFDFEGSDSTLAASTISGGIYSSTSASSTSSSTATPSSSSTTSSSSSSSSSTPISSSITSSISSSASSSVSSSSASSSGSISSADAKTVSASSNSTISGFSTSTTSASSSAAGNSSSSSYTSYSGAVSNGVAQLSVAACMGIAALMLIA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
207 | N-linked_Glycosylation | KTVSASSNSTISGFS CEEECCCCCEECCCE | 40.45 | - | |
227 | N-linked_Glycosylation | ASSSAAGNSSSSSYT CCCCCCCCCCCCCCC | 33.71 | - | |
242 | GPI-anchor | SYSGAVSNGVAQLSV CCCCCCCCCHHHHHH | 42.22 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YCDA_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YCDA_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YCDA_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YCDA_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...