UniProt ID | RL1DA_SCHPO | |
---|---|---|
UniProt AC | Q9Y7R7 | |
Protein Name | Putative ribosome biogenesis protein C306.07c | |
Gene Name | SPCC306.07c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 284 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Involved in rRNA-processing and ribosome biosynthesis.. | |
Protein Sequence | MAITSEKKKNLKSLDKIDIKLLEKTIRALLQHIRSSDKPIEKEKVYIQVNTFQPVEKESLRRPSKVFLPHRIMHVTDACLIVKDSQQTYQDLVEQQGLDEVITKVLSIPRLKLKYKTIREKCELRDSHNLFLVDDRVLKYIPLLMGKVFEQKKIKPFPISVLQKKETLRNQVARCLHSTYLKLSAGTSHTILCGLATQTNEQLLENITTVLKCLLTNFIPKGWSAIDNVAIKTADSASLPIWTSDTNLAAHKRHIVHIQDARPLKKSELRAQKRGSSGEGKGNK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of RL1DA_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL1DA_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL1DA_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL1DA_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YAS2_SCHPO | csr102 | genetic | 22681890 | |
YC93_SCHPO | SPCC584.03c | genetic | 22681890 | |
GPD1_SCHPO | gpd1 | genetic | 22681890 | |
UTP16_SCHPO | utp16 | genetic | 22681890 | |
GET1_SCHPO | get1 | genetic | 22681890 | |
SWD1_SCHPO | swd1 | genetic | 22681890 | |
SKI2_SCHPO | SPCC550.03c | genetic | 22681890 | |
PFD3_SCHPO | pac10 | genetic | 22681890 | |
YLM6_SCHPO | SPAC19B12.06c | genetic | 22681890 | |
YG42_SCHPO | rrp2 | genetic | 22681890 | |
TRM6_SCHPO | gcd10 | genetic | 22681890 | |
MUG51_SCHPO | mug51 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...