UniProt ID | UBLH2_SCHPO | |
---|---|---|
UniProt AC | Q9UUB6 | |
Protein Name | Ubiquitin carboxyl-terminal hydrolase 2 | |
Gene Name | uch2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 300 | |
Subcellular Localization | Nucleus . | |
Protein Description | Ubiquitin-protein hydrolase is involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin.. | |
Protein Sequence | MSWTTIESDAGVFTDLIENLGVKDVEVDELYSLDVDSLRQFPDIYGIIFLFKWNSKVDKPDGTMDYDSMDNIFFAKQVINNACATQALLSVLLNHSDEIDLGTTLSEFKDFSKTLPPELKGEALGNSEHIRCCHNSFARSDPFISEEVRAATDEDEVYHFIAYTNINNVFYELDGLQAAPINHGSCTKEEFAEKAVSVIQARIANYDPAEIRFNLMVICKDKKASLLTREDLTDEEKAASIAVEDEKRLRWKRENQLRRHNFVGLFVELSKLLVKDRIDKNTWNSTLETAKAKYASQKRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBLH2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBLH2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBLH2_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...