UniProt ID | PSB2_SCHPO | |
---|---|---|
UniProt AC | Q09841 | |
Protein Name | Probable proteasome subunit beta type-2 | |
Gene Name | pup1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 267 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (Potential).. | |
Protein Sequence | MMGINERKGFDFEYYQRNLLLQEKGFPTPKATSTGTTIVGVIAKDCIVLGADTRATAGPIIADKNCKKLHLISPNIWCAGAGTAADTEFVTSMISSNIELHSLYTNRKPRVVTALTMLKQHLFRYQGHIGAYLVLGGYDCKGPHLFTIAAHGSSDKLPYVALGSGSLAAISVLETKYQPDLERHEAMELVKEAIEAGIFNDLGSGSNCDLVVIDEEKATPYRGYSKPNERATKQSKYTYDRGTTAVLKEDIYKFVTVQDLDEMQVDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PSB2_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSB2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSB2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSB2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PSB2_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...