PSA1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSA1_SCHPO
• UniProt AC: O94517
• Protein Name: Probable proteasome subunit alpha type-1
• Gene Name: SPBC646.16
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 244
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)..
• Protein Sequence: MSQARGFDRTITVFSPEGRLYQVEYAFKAFNNAGITSVGVTGKNCACVISQKKVPDKLIDASTVKHVFPITKGIGCVMTGSIADARAQVSRARSEAAEFEYKNGYPMPCDVLAKRMANIAQVSTQRAAMRPLGVAMTLVAVDDEIGPSLFKLDPAGFYIGYKATSAGPKQTETINWLEKRFKKDGIPSNLTDTVETGIQALMSSLSTDFKSTELQIGVVEDDKPFRVLSVEEIEAHLQSIAEKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	DRTITVFSPEGRLYQ CCEEEEECCCCCEEE	32.01	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSA1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSA1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSA1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PSA2_SCHPO	pre8	physical	22307589
PSA7_SCHPO	pre10	physical	22307589
PRS10_SCHPO	rpt4	physical	22307589

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.