dbPTM

PSA7_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PSA7_SCHPO
UniProt AC	O59770
Protein Name	Probable proteasome subunit alpha type-7
Gene Name	pre10
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	253
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)..
Protein Sequence	MSSIGTGYDLGLFFSPDGRLFQAEYAYKAVENASTCIGIKCEDGVILALEKVVTSKLLKPRVNNRIGSVDRHIGIATTGFIPDGQHIVKRARDEATSWRDNYGSPIPGTVIADRLGNYVQLFTCYSSVRPFGVMSFVATYDSEGPHLYMVEPNGVYWGYNGAAAGKGRQVARNELEKLNFSSLKMKDAVKEAARILYATHDEENNKEHEIEMTWVGVETNGIHTPVPDELLQEAEAYARRIADGEEEDIAMQE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
104	Phosphorylation	SWRDNYGSPIPGTVI CHHCCCCCCCCCCEE	18.32	28889911
109	Phosphorylation	YGSPIPGTVIADRLG CCCCCCCCEEHHHCC	21.03	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PSA7_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PSA7_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PSA7_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PSA7_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PSA7_SCHPO

Related Literatures of Post-Translational Modification