RL25B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL25B_SCHPO
• UniProt AC: O74391
• Protein Name: 60S ribosomal protein L25-B
• Gene Name: rpl2502
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 141
• Protein Description: This protein binds to a specific region on the 26S rRNA..
• Protein Sequence: MSVGKAKGAQKTVQKGIHNKVARKVRTSTTFRRPKTLELARKPKYARKSVPHASRLDEYKIIVNPINSESAMKKIEDDNTLVFHVHLKANKFTIKNAVKKLYSVDAVKINTLIRPNGTKKAFVKLSADADALDVANRIGFL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	Phosphorylation	KVARKVRTSTTFRRP HHHHHHCCCCCCCCC	33.15	25720772
28	Phosphorylation	VARKVRTSTTFRRPK HHHHHCCCCCCCCCC	18.19	29996109
29	Phosphorylation	ARKVRTSTTFRRPKT HHHHCCCCCCCCCCH	29.37	29996109
49	Phosphorylation	KPKYARKSVPHASRL CCCCCCCCCCCCHHC	35.01	25720772
68	Phosphorylation	IIVNPINSESAMKKI EEEECCCCHHHHHHH	33.38	28889911
70	Phosphorylation	VNPINSESAMKKIED EECCCCHHHHHHHCC	33.22	28889911
103	Phosphorylation	NAVKKLYSVDAVKIN HHHHHHCCCCEEEEE	24.77	25720772
126	Phosphorylation	KKAFVKLSADADALD CEEEEEECCCHHHHH	20.56	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL25B_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL25B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL25B_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RL25B_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.