UniProt ID | RL25B_SCHPO | |
---|---|---|
UniProt AC | O74391 | |
Protein Name | 60S ribosomal protein L25-B | |
Gene Name | rpl2502 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 141 | |
Subcellular Localization | ||
Protein Description | This protein binds to a specific region on the 26S rRNA.. | |
Protein Sequence | MSVGKAKGAQKTVQKGIHNKVARKVRTSTTFRRPKTLELARKPKYARKSVPHASRLDEYKIIVNPINSESAMKKIEDDNTLVFHVHLKANKFTIKNAVKKLYSVDAVKINTLIRPNGTKKAFVKLSADADALDVANRIGFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Phosphorylation | KVARKVRTSTTFRRP HHHHHHCCCCCCCCC | 33.15 | 25720772 | |
28 | Phosphorylation | VARKVRTSTTFRRPK HHHHHCCCCCCCCCC | 18.19 | 29996109 | |
29 | Phosphorylation | ARKVRTSTTFRRPKT HHHHCCCCCCCCCCH | 29.37 | 29996109 | |
49 | Phosphorylation | KPKYARKSVPHASRL CCCCCCCCCCCCHHC | 35.01 | 25720772 | |
68 | Phosphorylation | IIVNPINSESAMKKI EEEECCCCHHHHHHH | 33.38 | 28889911 | |
70 | Phosphorylation | VNPINSESAMKKIED EECCCCHHHHHHHCC | 33.22 | 28889911 | |
103 | Phosphorylation | NAVKKLYSVDAVKIN HHHHHHCCCCEEEEE | 24.77 | 25720772 | |
126 | Phosphorylation | KKAFVKLSADADALD CEEEEEECCCHHHHH | 20.56 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL25B_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL25B_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL25B_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL25B_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...