dbPTM

YF94_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YF94_SCHPO
UniProt AC	O42645
Protein Name	RCC1 repeat-containing protein C10F6.04
Gene Name	SPAC10F6.04
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	351
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description
Protein Sequence	MLLSLGSNGNFQLGLNNDEDVYSPQIVPFDRAIEKISCGGNHTLLLDEDSQLWACGDNRKGQCGYEVKEPLYNPLSPDYLRIFTRVSHERWVFLTCGWEFSVIVHADRRRVCSCGEGLSGELGQGNRSNSQGLREIDIPYLDDKEFIIDISAGLRHWICVTNEGNLYGCGDGRKGQLGPVVMKTVNKVSFLGRIEHAQAVVCGVQFSAVLQETGHVIVLGGEKWNVAAECDAWQANNSELSSSICSISANWSTLSLLSTEGCVYAFGRCDRAQKAHTKASDIVQIASGTEHNILRTKKGSVLIYGWNEHGNASNDDKRDVYDAKTLQLPGWAYIVAAGYATSWIVIEENHK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YF94_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YF94_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YF94_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YF94_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELP3_SCHPO	elp3	genetic	19547744
YII3_SCHPO	toe2	physical	26771498
YI35_SCHPO	toe1	physical	26771498
DPH3_SCHPO	dph3	physical	26771498
CHAC_SCHPO	SPBC31F10.03	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YF94_SCHPO

Related Literatures of Post-Translational Modification